StarFunc result for job id Q3BBV0

User Input

>input (1214 residues)
MVVSAGPWSSEKAETNILEINEKLRPQLAENKQQFRNLKEKCFVTQLAGFLANRQKKYKY
EECKDLIKFMLRNERQFKEEKLAEQLKQAEELRQYKVLVHSQERELTQLREKLREGRDAS
RSLNQHLQALLTPDKPDKSQGQDLQEQLAEGCRLAQQLFQKLSPENDEDEDEDVQVEEAE
KVLESSAPREVQKAEESKVPEDSLEECAITCSNSHSPCDSNQPHKNINITFEEDKVNSTL
VVDRESSHDECQDAVNILPVPGPTSSATNVSMVVSAGPLSSEKAEMNILEINEKLHPQLA
EKKQQFRNLKEKCFVTQLACFLANQQNKYKYEECKDLIKSMLRNERQFKEEKLAEQLKQA
EELRQYKVLVHSQERELTQLREKLREGRDASRSLNQHLQALLTPDKPDKSQGQDLQEQLA
EGCRLAQQLFQKLSPENDEDEDEDVQVEEAEKVLESSAPREVQKAEESKVPEDSLEECAI
TCSNSHGPCDSNQPHKNINITFEEDKVNSALVVDRESSHDECQDAVNILPVPGPTSSATN
VSMVVSAGPLSSEKAEMNILEINEKLHPQLAEKKQQFRNLKEKCFVTQLACFLANQQNKY
KNEECKDLIKSMLRNERQFKEEKLAEQLKQAEELRQYKVLVHSQERELTQLREKLREGRD
ASCSLNQHLQALLTPDEPDKSQGQDLQEQLAEGCRLAQHLVQKLSPENDNDDDEDVQVEV
AEKVQKSSAPREMPKAEEKEVPEDSLEECAITCSNSHGPYDSNQPHRKTKITFEEDKVDS
TLIGSSSHVEWEDAVHIIPENESDDEEEEEKGPVSPRNLQESEEEEVPQESWDEGYSTLS
IPPEMLASYKSYSGTFHSLEEQQVCMAVDIGGHRWDQVKKEDQEATGPRLSRELLDEKGP
EVLQDSLDRCYSTPSGYLELTDSCQPYRSAFYILEQQRVGWALDMDEIEKYQEVEEDQDP
SCPRLSRELLDEKEPEVLQDSLDRCYSTPSGYLELPDLGQPYRSAVYSLEEQYLGLALDV
DRIKKDQEEEEDQGPPCPRLSRELLEAVEPEVLQDSLDRCYSTPSSCLEQPDSCLPYGSS
FYALEEKHVGFSLDVGEIEKKGKGKKRRGRRSTKKRRRRGRKEGEEDQNPPCPRLSGMLM
EVEEPEVLQDSLDRCYSTPSMYFELPDSFQHYRSVFYSFEEQHISFALDVDNRFLTLMGT
SLHLVFQMGVIFPQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3BBV0	1.000	1.000	0.000	1214	1.000	1.000	Q3BBV0.pdb.gz	NBPF1_HUMAN Neuroblastoma breakpoint family member 1 OS=Homo sapiens OX=9606 GN=NBPF1 PE=1 SV=2
2	AFDB:P0DPF3	0.220	0.239	3.253E-97	1111	0.736	0.805	P0DPF3.pdb.gz	NBPF9_HUMAN Neuroblastoma breakpoint family member 9 OS=Homo sapiens OX=9606 GN=NBPF9 PE=2 SV=1
3	AFDB:A0A2K7P776	0.210	0.289	2.135E-90	867	0.691	0.968	A0A2K7P776.pdb.gz	A0A2K7P776_HUMAN NBPF9 isoform 1 OS=Homo sapiens OX=9606 PE=1 SV=1
4	AFDB:Q6P3W6	0.217	0.303	6.334E-87	841	0.653	0.943	Q6P3W6.pdb.gz	NBPFA_HUMAN Neuroblastoma breakpoint family member 10 OS=Homo sapiens OX=9606 GN=NBPF10 PE=3 SV=3
5	AFDB:Q6XZL8	0.058	0.048	7.715E-5	1540	0.118	0.093	Q6XZL8.pdb.gz	Q6XZL8_MOUSE Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Mus musculus OX=10090 GN=Dot1l PE=1 SV=1
6	AFDB:Q55F37	0.046	0.054	9.760E-5	1048	0.102	0.118	Q55F37.pdb.gz	SRFC_DICDI Transcription factor mef2A OS=Dictyostelium discoideum OX=44689 GN=mef2A PE=2 SV=2
7	AFDB:Q5YL88	0.050	0.050	2.096E-4	1205	0.110	0.110	Q5YL88.pdb.gz	Q5YL88_MOUSE Histone-lysine N-methyltransferase, H3 lysine-79 specific (Fragment) OS=Mus musculus OX=10090 GN=Dot1l PE=2 SV=1
8	AFDB:P48681	0.062	0.048	2.357E-4	1621	0.172	0.129	P48681.pdb.gz	NEST_HUMAN Nestin OS=Homo sapiens OX=9606 GN=NES PE=1 SV=2
9	AFDB:A0A1D8PF53	0.053	0.050	4.501E-4	1296	0.110	0.103	A0A1D8PF53.pdb.gz	A0A1D8PF53_CANAL Cta3p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CTA3 PE=4 SV=1
10	AFDB:Q9HGL2	0.073	0.079	5.062E-4	1116	0.082	0.089	Q9HGL2.pdb.gz	YHLA_SCHPO Uncharacterized calcium-binding protein C800.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC800.10c PE=4 SV=1
11	PDB:2p22C	0.045	0.238	8.782E-2	186	0.024	0.156	2p22C.pdb.gz
12	PDB:7rroD1	0.062	0.147	2.250E-1	425	0.022	0.064	7rroD1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
13	PDB:7ungD2	0.060	0.148	6.112E-1	398	0.018	0.055	7ungD2.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
14	PDB:7rroA1	0.063	0.155	8.697E-1	396	0.017	0.053	7rroA1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
15	PDB:7rroA3	0.068	0.207	1.167	334	0.016	0.057	7rroA3.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
16	PDB:7ungB0	0.039	0.163	1.167	193	0.022	0.140	7ungB0.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
17	PDB:7aqsE	0.040	0.285	1.660	159	0.007	0.050	7aqsE.pdb.gz	Identification of a Dps contamination in Mitomycin-C-induced expression of Colicin Ia.
18	PDB:1yo7A	0.042	0.377	1.761	120	0.013	0.133	1yo7A.pdb.gz	Structure of the ColE1 rop protein at 1.7 A resolution
19	PDB:7ungA1	0.063	0.155	1.761	391	0.016	0.049	7ungA1.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
20	PDB:6k1zA	0.067	0.134	1.981	544	0.017	0.039	6k1zA.pdb.gz	Structural mechanism for guanylate-binding proteins (GBPs) targeting by the Shigella E3 ligase IpaH9.8.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WUL8	0.0	1024	3843	0.481	0.152	NBPFJ_HUMAN Neuroblastoma breakpoint family member 19 OS=Homo sapiens OX=9606 GN=NBPF19 PE=5 SV=1
2	A0A2K7P776	0.0	1372	867	0.618	0.865	A0A2K7P776_HUMAN NBPF9 isoform 1 OS=Homo sapiens OX=9606 PE=1 SV=1
3	P0DPF2	0.0	600	5207	0.293	0.068	NBPFK_HUMAN Neuroblastoma breakpoint family member 20 OS=Homo sapiens OX=9606 GN=NBPF20 PE=3 SV=1
4	P0DPF3	0.0	1524	1111	0.691	0.755	NBPF9_HUMAN Neuroblastoma breakpoint family member 9 OS=Homo sapiens OX=9606 GN=NBPF9 PE=2 SV=1
5	Q3BBV0	0.0	2470	1214	1.000	1.000	NBPF1_HUMAN Neuroblastoma breakpoint family member 1 OS=Homo sapiens OX=9606 GN=NBPF1 PE=1 SV=2
6	Q5TI25	0.0	594	921	0.284	0.375	NBPFE_HUMAN Neuroblastoma breakpoint family member 14 OS=Homo sapiens OX=9606 GN=NBPF14 PE=2 SV=2
7	Q6P3W6	0.0	1342	3795	0.675	0.216	NBPFA_HUMAN Neuroblastoma breakpoint family member 10 OS=Homo sapiens OX=9606 GN=NBPF10 PE=3 SV=3
8	Q5VU43	2.86e-10	67.8	2346	0.048	0.025	MYOME_HUMAN Myomegalin OS=Homo sapiens OX=9606 GN=PDE4DIP PE=1 SV=3
9	B7ZNY0	1.17e-09	65.5	2412	0.050	0.025	B7ZNY0_MOUSE Pde4dip protein OS=Mus musculus OX=10090 GN=Pde4dip PE=1 SV=1
10	Q80YT7	1.86e-09	65.1	2224	0.046	0.025	MYOME_MOUSE Myomegalin OS=Mus musculus OX=10090 GN=Pde4dip PE=1 SV=2
11	M9PI41	0.086	39.7	1858	0.038	0.025	M9PI41_DROME Sticky, isoform B OS=Drosophila melanogaster OX=7227 GN=sti PE=1 SV=1
12	Q9VTY8	0.086	39.7	1854	0.038	0.025	Q9VTY8_DROME FI02033p OS=Drosophila melanogaster OX=7227 GN=sti PE=1 SV=2
13	Q9WUJ3	0.12	39.3	2324	0.026	0.014	MYOME_RAT Myomegalin OS=Rattus norvegicus OX=10116 GN=Pde4dip PE=1 SV=1
14	F8W785	8.7	33.1	668	0.023	0.042	F8W785_HUMAN Golgi integral membrane protein 4 OS=Homo sapiens OX=9606 GN=GOLIM4 PE=1 SV=1
15	O00461	9.4	32.7	696	0.023	0.040	GOLI4_HUMAN Golgi integral membrane protein 4 OS=Homo sapiens OX=9606 GN=GOLIM4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06869 DUF1258	43	15.0	Protein of unknown function (DUF1258)
2	PF03127 GAT	0.48	22.0	GAT domain
3	PF06758 Olduvai	1e-178	591.1	Olduvai domain
4	PF07521 RMMBL	5.1	18.5	Zn-dependent metallo-hydrolase RNA specificity domain
5	PF18335 SH3_13	14	16.9	ATP-dependent RecD-like DNA helicase SH3 domain
6	PF09017 Transglut_prok	9.7e+02	10.5	Microbial transglutaminase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000478609

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000478962	0.831	Protein chibby homolog 1
2	9606.ENSP00000320324	0.814	Puromycin-sensitive aminopeptidase
3	9606.ENSP00000320401	0.814	UDP-glucuronosyltransferase 2B17
4	9606.ENSP00000377197	0.814	Hydrocephalus-inducing protein homolog
5	9606.ENSP00000363436	0.812	G protein-regulated inducer of neurite outgrowth 2
6	9606.ENSP00000393845	0.812	Peptidyl-prolyl cis-trans isomerase A-like 4G
7	9606.ENSP00000463057	0.812	Peptidyl-prolyl cis-trans isomerase A-like 4C
8	9606.ENSP00000463419	0.812	Peptidylprolyl isomerase A like 4F
9	9606.ENSP00000464619	0.812	Peptidyl-prolyl cis-trans isomerase
10	9606.ENSP00000485206	0.812	PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity)
11	9606.ENSP00000485638	0.812	annotation not available
12	9606.ENSP00000459615	0.772	SLIT-ROBO Rho GTPase-activating protein 2
13	9606.ENSP00000373347	0.768	SLIT-ROBO Rho GTPase-activating protein 3
14	9606.ENSP00000306129	0.767	D(1B) dopamine receptor
15	9606.ENSP00000460070	0.740	General transcription factor II-I
16	9606.ENSP00000485398	0.561	speedy/RINGO cell cycle regulator family member E5
17	9606.ENSP00000359356	0.517	Ecotropic viral integration site 5 protein homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.965	biological regulation
GO:0009987	0.948	cellular process
GO:0050789	0.911	regulation of biological process
GO:0050794	0.775	regulation of cellular process
GO:0048518	0.344	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043229	0.996	intracellular organelle
GO:0005856	0.979	cytoskeleton
GO:0043227	0.946	membrane-bounded organelle
GO:0016020	0.915	membrane
GO:0071944	0.856	cell periphery
GO:0043231	0.846	intracellular membrane-bounded organelle
GO:0005886	0.540	plasma membrane
GO:0012505	0.482	endomembrane system
GO:0031981	0.426	nuclear lumen
GO:0005654	0.406	nucleoplasm
GO:0005829	0.345	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]