StarFunc result for job id Q3KNW1

User Input

>input (292 residues)
MPRSFLVKTHSSHRVPNYRRLETQREINGACSACGGLVVPLLPRDKEAPSVPGDLPQPWD
RSSAVACISLPLLPRIEEALGASGLDALEVSEVDPRASRAAIVPLKDSLNHLNLPPLLVL
PTRWSPTLGPDRHGAPEKLLGAERMPRAPGGFECFHCHKPYHTLAGLARHRQLHCHLQVG
RVFTCKYCDKEYTSLGALKMHIRTHTLPCTCKICGKAFSRPWLLQGHVRTHTGEKPYACS
HCSRAFADRSNLRAHLQTHSDAKKYRCRRCTKTFSRMSLLARHEESGCCPGP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3KNW1	1.000	1.000	1.125E-54	292	1.000	1.000	Q3KNW1.pdb.gz	SNAI3_HUMAN Zinc finger protein SNAI3 OS=Homo sapiens OX=9606 GN=SNAI3 PE=2 SV=1
2	AFDB:P97469	0.469	0.508	1.948E-25	269	0.462	0.502	P97469.pdb.gz	SNAI2_MOUSE Zinc finger protein SNAI2 OS=Mus musculus OX=10090 GN=Snai2 PE=1 SV=1
3	AFDB:P19382	0.467	0.524	2.454E-23	259	0.466	0.525	P19382.pdb.gz	SNAI1_XENLA Protein snail homolog Sna OS=Xenopus laevis OX=8355 GN=snai1 PE=1 SV=1
4	AFDB:Q90414	0.401	0.450	1.580E-19	257	0.432	0.490	Q90414.pdb.gz
5	AFDB:Q91367	0.381	0.422	2.529E-18	263	0.404	0.449	Q91367.pdb.gz
6	AFDB:G5ECN8	0.360	0.388	7.233E-17	270	0.253	0.274	G5ECN8.pdb.gz	G5ECN8_CAEEL C2H2-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ces-1 PE=1 SV=1
7	AFDB:Q9EQB9	0.353	0.145	1.818E-15	759	0.219	0.084	Q9EQB9.pdb.gz	ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus OX=10090 GN=Znf287 PE=2 SV=2
8	AFDB:Q9NQZ8	0.386	0.244	3.465E-15	489	0.250	0.149	Q9NQZ8.pdb.gz	ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens OX=9606 GN=ZNF71 PE=1 SV=1
9	AFDB:Q9UEG4	0.391	0.144	7.043E-15	869	0.277	0.093	Q9UEG4.pdb.gz	ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens OX=9606 GN=ZNF629 PE=1 SV=2
10	AFDB:Q96NL3	0.382	0.204	1.037E-14	588	0.260	0.129	Q96NL3.pdb.gz	ZN599_HUMAN Zinc finger protein 599 OS=Homo sapiens OX=9606 GN=ZNF599 PE=1 SV=1
11	PDB:3w5kB	0.165	0.341	5.790E-11	110	0.295	0.782	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6ydhA	0.065	0.200	1.172	62	0.051	0.242	6ydhA.pdb.gz
13	PDB:7uhyC	0.074	0.045	2.094	578	0.038	0.019	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
14	PDB:7ad8D	0.075	0.078	3.741	280	0.082	0.086	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
15	PDB:6hlqI	0.059	0.127	4.539	111	0.041	0.108	6hlqI.pdb.gz	The cryo-EM structure of a 12-subunit variant of RNA polymerase I reveals dissociation of the A49-A34.5 heterodimer and rearrangement of subunit A12.2.
16	PDB:6gejS	0.096	0.132	4.842	208	0.062	0.087	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
17	PDB:5lj5t	0.070	0.051	5.164	438	0.027	0.018	5lj5t.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
18	PDB:6t9lN	0.086	0.271	5.164	82	0.041	0.146	6t9lN.pdb.gz	Structure of the transcription coactivator SAGA.
19	PDB:7egb3	0.053	0.057	5.164	263	0.041	0.046	7egb3.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
20	PDB:6htsR	0.081	0.289	5.875	72	0.045	0.181	6htsR.pdb.gz	Structure and regulation of the human INO80-nucleosome complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3KNW1	0.0	595	292	1.000	1.000	SNAI3_HUMAN Zinc finger protein SNAI3 OS=Homo sapiens OX=9606 GN=SNAI3 PE=2 SV=1
2	Q9QY31	4.27e-148	418	287	0.733	0.746	SNAI3_MOUSE Zinc finger protein SNAI3 OS=Mus musculus OX=10090 GN=Snai3 PE=2 SV=1
3	O08954	6.52e-82	249	268	0.500	0.545	SNAI2_RAT Zinc finger protein SNAI2 OS=Rattus norvegicus OX=10116 GN=Snai2 PE=2 SV=2
4	P97469	4.11e-80	245	269	0.493	0.535	SNAI2_MOUSE Zinc finger protein SNAI2 OS=Mus musculus OX=10090 GN=Snai2 PE=1 SV=1
5	O43623	7.48e-80	244	268	0.503	0.549	SNAI2_HUMAN Zinc finger protein SNAI2 OS=Homo sapiens OX=9606 GN=SNAI2 PE=1 SV=1
6	Q91051	1.52e-78	241	268	0.476	0.519	Q91051_9GALL Slug protein OS=Gallus sp. OX=9036 GN=Slug PE=2 SV=1
7	Q91924	3.06e-78	240	266	0.503	0.553	SNAI2_XENLA Zinc finger protein SNAI2 OS=Xenopus laevis OX=8355 GN=snai2 PE=1 SV=1
8	P19382	3.45e-75	232	259	0.349	0.394	SNAI1_XENLA Protein snail homolog Sna OS=Xenopus laevis OX=8355 GN=snai1 PE=1 SV=1
9	Q9U7P8	1.05e-66	219	548	0.342	0.182	Q9U7P8_DROME Zinc finger protein Worniu OS=Drosophila melanogaster OX=7227 GN=wor PE=2 SV=1
10	Q8SXL3	1.08e-66	219	548	0.342	0.182	Q8SXL3_DROME RE10012p OS=Drosophila melanogaster OX=7227 GN=wor PE=2 SV=1
11	Q9VJP2	1.09e-66	219	548	0.342	0.182	Q9VJP2_DROME Worniu OS=Drosophila melanogaster OX=7227 GN=wor PE=4 SV=1
12	P25932	8.77e-66	214	470	0.384	0.238	ESCA_DROME Protein escargot OS=Drosophila melanogaster OX=7227 GN=esg PE=1 SV=2
13	Q02085	6.52e-64	203	264	0.452	0.500	SNAI1_MOUSE Zinc finger protein SNAI1 OS=Mus musculus OX=10090 GN=Snai1 PE=1 SV=1
14	Q6AY35	4.02e-63	201	264	0.452	0.500	Q6AY35_RAT Snail homolog 1 (Drosophila) OS=Rattus norvegicus OX=10116 GN=Snai1 PE=2 SV=1
15	O95863	6.01e-62	198	264	0.312	0.345	SNAI1_HUMAN Zinc finger protein SNAI1 OS=Homo sapiens OX=9606 GN=SNAI1 PE=1 SV=2
16	B3DH44	1.23e-60	195	256	0.325	0.371	B3DH44_DANRE LOC792194 protein OS=Danio rerio OX=7955 GN=LOC792194 PE=2 SV=1
17	P08044	8.31e-58	192	390	0.308	0.231	SNAI_DROME Protein snail OS=Drosophila melanogaster OX=7227 GN=sna PE=1 SV=2
18	Q90274	1.62e-56	184	260	0.277	0.312	Q90274_DANRE Sna-1 protein OS=Danio rerio OX=7955 GN=sna1 PE=2 SV=1
19	Q6YI50	9.56e-49	166	312	0.274	0.256	Q6YI50_DANRE Scratch-a transcription factor OS=Danio rerio OX=7955 GN=scrta PE=2 SV=1
20	Q9W0P9	2.29e-47	166	442	0.260	0.172	Q9W0P9_DROME Kahuli OS=Drosophila melanogaster OX=7227 GN=Kah PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07213 DAP10	95	14.4	DAP10 membrane protein
2	PF02892 zf-BED	2.1e+02	13.3	BED zinc finger
3	PF00096 zf-C2H2	1.3e-20	83.8	Zinc finger, C2H2 type
4	PF13894 zf-C2H2_4	3.2e-13	60.3	C2H2-type zinc finger
5	PF13912 zf-C2H2_6	0.042	25.1	C2H2-type zinc finger
6	PF12171 zf-C2H2_jaz	5.3e-08	44.2	Zinc-finger double-stranded RNA-binding
7	PF16278 zf-C2HE	3.5	19.5	C2HE / C2H2 / C2HC zinc-binding finger
8	PF13465 zf-H2C2_2	1.8e-10	52.0	Zinc-finger double domain
9	PF13909 zf-H2C2_5	1.2e+02	13.9	C2H2-type zinc-finger domain
10	PF12874 zf-met	0.0074	27.9	Zinc-finger of C2H2 type
11	PF17032 zinc_ribbon_15	58	15.9	zinc-ribbon family
12	PF09723 Zn-ribbon_8	2.5e+02	13.2	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000327968

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261769	0.954	Cadherin-1
2	9606.ENSP00000362649	0.941	Histone deacetylase 1
3	9606.ENSP00000412302	0.903	Methyl-CpG-binding domain protein 3
4	9606.ENSP00000383973	0.901	Metastasis-associated protein MTA3
5	9606.ENSP00000482581	0.656	Twist-related protein 2
6	9606.ENSP00000242261	0.624	Twist-related protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1990837	0.999	sequence-specific double-stranded DNA binding
GO:0140110	0.856	transcription regulator activity
GO:0000977	0.712	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0003700	0.558	DNA-binding transcription factor activity
GO:0000981	0.450	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000987	0.375	cis-regulatory region sequence-specific DNA binding
GO:0003682	0.300	chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.999	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0019222	0.990	regulation of metabolic process
GO:0048519	0.985	negative regulation of biological process
GO:0060255	0.984	regulation of macromolecule metabolic process
GO:0051171	0.982	regulation of nitrogen compound metabolic process
GO:0009889	0.981	regulation of biosynthetic process
GO:0010468	0.947	regulation of gene expression
GO:0006355	0.937	regulation of DNA-templated transcription
GO:0048523	0.920	negative regulation of cellular process
GO:0010605	0.907	negative regulation of macromolecule metabolic process
GO:1902679	0.896	negative regulation of RNA biosynthetic process
GO:0045892	0.894	negative regulation of DNA-templated transcription
GO:0009987	0.873	cellular process
GO:0006357	0.779	regulation of transcription by RNA polymerase II
GO:0000122	0.569	negative regulation of transcription by RNA polymerase II
GO:0048518	0.471	positive regulation of biological process
GO:0048522	0.443	positive regulation of cellular process
GO:0009893	0.408	positive regulation of metabolic process
GO:0010604	0.388	positive regulation of macromolecule metabolic process
GO:0051173	0.385	positive regulation of nitrogen compound metabolic process
GO:0050896	0.377	response to stimulus
GO:0031325	0.362	positive regulation of cellular metabolic process
GO:0031328	0.332	positive regulation of cellular biosynthetic process
GO:0071840	0.321	cellular component organization or biogenesis
GO:0010557	0.313	positive regulation of macromolecule biosynthetic process
GO:0016043	0.304	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0032991	0.995	protein-containing complex
GO:0070013	0.991	intracellular organelle lumen
GO:0005654	0.984	nucleoplasm
GO:0005667	0.911	transcription regulator complex
GO:0043232	0.735	intracellular non-membrane-bounded organelle
GO:0005737	0.618	cytoplasm
GO:0005694	0.494	chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]