StarFunc result for job id Q3KP31

User Input

>input (576 residues)
MDSVAFEDVSVSFSQEEWALLAPSQKKLYRDVMQETFKNLASIGEKWEDPNVEDQHKNQG
RNLRSHTGERLCEGKEGSQCAENFSPNLSVTKKTAGVKPYECTICGKAFMRLSSLTRHMR
SHTGYELFEKPYKCKECEKAFSYLKSFQRHERSHTGEKPYKCKQCGKTFIYHQPFQRHER
THIGEKPYECKQCGKALSCSSSLRVHERIHTGEKPYECKQCGKAFSCSSSIRVHERTHTG
EKPYACKECGKAFISHTSVLTHMITHNGDRPYKCKECGKAFIFPSFLRVHERIHTGEKPY
KCKQCGKAFRCSTSIQIHERIHTGEKPYKCKECGKSFSARPAFRVHVRVHTGEKPYKCKE
CGKAFSRISYFRIHERTHTGEKPYECKKCGKTFNYPLDLKIHKRNHTGEKPYECKECAKT
FISLENFRRHMITHTGDGPYKCRDCGKVFIFPSALRTHERTHTGEKPYECKQCGKAFSCS
SYIRIHKRTHTGEKPYECKECGKAFIYPTSFQGHMRMHTGEKPYKCKECGKAFSLHSSFQ
RHTRIHNYEKPLECKQCGKAFSVSTSLKKHMRMHNR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3KP31	1.000	1.000	3.087E-97	576	1.000	1.000	Q3KP31.pdb.gz	ZN791_HUMAN Zinc finger protein 791 OS=Homo sapiens OX=9606 GN=ZNF791 PE=1 SV=1
2	AFDB:Q8N7K0	0.462	0.406	2.638E-64	673	0.580	0.496	Q8N7K0.pdb.gz	ZN433_HUMAN Zinc finger protein 433 OS=Homo sapiens OX=9606 GN=ZNF433 PE=1 SV=1
3	AFDB:A0A0U1RQ46	0.567	0.542	2.295E-63	609	0.550	0.521	A0A0U1RQ46.pdb.gz	A0A0U1RQ46_MOUSE Zinc finger protein 950 OS=Mus musculus OX=10090 GN=Zfp950 PE=4 SV=1
4	AFDB:Q99PJ6	0.495	0.399	2.762E-62	736	0.573	0.448	Q99PJ6.pdb.gz	Q99PJ6_RAT RCG38839 OS=Rattus norvegicus OX=10116 GN=Zfp709 PE=2 SV=1
5	AFDB:E9Q981	0.608	0.559	4.357E-61	636	0.530	0.480	E9Q981.pdb.gz	E9Q981_MOUSE Zinc finger protein 976 OS=Mus musculus OX=10090 GN=Zfp976 PE=4 SV=1
6	AFDB:Q5MCW4	0.582	0.500	1.035E-60	686	0.519	0.436	Q5MCW4.pdb.gz	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
7	AFDB:Q9P2J8	0.605	0.430	5.844E-60	865	0.490	0.326	Q9P2J8.pdb.gz	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
8	AFDB:Q32M78	0.486	0.443	5.666E-59	642	0.550	0.494	Q32M78.pdb.gz	ZN699_HUMAN Zinc finger protein 699 OS=Homo sapiens OX=9606 GN=ZNF699 PE=1 SV=1
9	AFDB:Q8IYB9	0.507	0.460	6.313E-59	648	0.500	0.444	Q8IYB9.pdb.gz	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
10	AFDB:Q9Y2A4	0.470	0.421	1.583E-58	671	0.545	0.468	Q9Y2A4.pdb.gz	ZN443_HUMAN Zinc finger protein 443 OS=Homo sapiens OX=9606 GN=ZNF443 PE=2 SV=2
11	PDB:3w5kB	0.088	0.251	1.978E-3	110	0.069	0.364	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:4fjcE	0.050	0.059	4.417E-1	434	0.069	0.092	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
13	PDB:5c8dE	0.093	0.147	1.802	280	0.040	0.082	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
14	PDB:5iv5O	0.055	0.058	1.802	526	0.031	0.034	5iv5O.pdb.gz	Structure of the T4 baseplate and its function in triggering sheath contraction.
15	PDB:7ena4	0.079	0.093	1.802	457	0.075	0.094	7ena4.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
16	PDB:2ad5B	0.078	0.082	1.903	536	0.059	0.063	2ad5B.pdb.gz	Mechanisms of Product Feedback Regulation and Drug Resistance in Cytidine Triphosphate Synthetases from the Structure of a CTP-Inhibited Complex(,).
17	PDB:5gm6a	0.034	0.119	1.903	123	0.033	0.154	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
18	PDB:7dvqM	0.049	0.096	1.903	191	0.052	0.157	7dvqM.pdb.gz	Structure of the activated human minor spliceosome.
19	PDB:4wa6D	0.061	0.075	2.120	415	0.036	0.051	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
20	PDB:7evoC	0.066	0.082	2.632	422	0.064	0.088	7evoC.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A087WSF4	597	635	0.535	0.485	A0A087WSF4_MOUSE Zinc finger protein 976 OS=Mus musculus OX=10090 GN=Zfp976 PE=4 SV=1
2	A0A0U1RQ46	634	609	0.547	0.517	A0A0U1RQ46_MOUSE Zinc finger protein 950 OS=Mus musculus OX=10090 GN=Zfp950 PE=4 SV=1
3	E9PZP6	524	546	0.486	0.513	E9PZP6_MOUSE Zinc finger protein 97 OS=Mus musculus OX=10090 GN=Zfp97 PE=4 SV=1
4	E9Q981	600	636	0.536	0.486	E9Q981_MOUSE Zinc finger protein 976 OS=Mus musculus OX=10090 GN=Zfp976 PE=4 SV=1
5	E9QAG8	576	526	0.502	0.549	ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus OX=10090 GN=Znf431 PE=1 SV=1
6	P17024	580	532	0.517	0.560	ZNF20_HUMAN Zinc finger protein 20 OS=Homo sapiens OX=9606 GN=ZNF20 PE=1 SV=2
7	P52737	609	540	0.552	0.589	ZN136_HUMAN Zinc finger protein 136 OS=Homo sapiens OX=9606 GN=ZNF136 PE=1 SV=1
8	Q32M78	572	642	0.538	0.483	ZN699_HUMAN Zinc finger protein 699 OS=Homo sapiens OX=9606 GN=ZNF699 PE=1 SV=1
9	Q3KP31	1174	576	1.000	1.000	ZN791_HUMAN Zinc finger protein 791 OS=Homo sapiens OX=9606 GN=ZNF791 PE=1 SV=1
10	Q5MCW4	540	686	0.516	0.433	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
11	Q61491	528	546	0.488	0.515	Q61491_MOUSE DNA-binding protein OS=Mus musculus OX=10090 GN=Zfp97 PE=2 SV=1
12	Q7TMN8	525	578	0.476	0.474	Q7TMN8_MOUSE Zfp420 protein OS=Mus musculus OX=10090 GN=Zfp420 PE=1 SV=1
13	Q7Z3V5	545	609	0.510	0.483	ZN571_HUMAN Zinc finger protein 571 OS=Homo sapiens OX=9606 GN=ZNF571 PE=2 SV=3
14	Q8BLA2	542	578	0.490	0.488	Q8BLA2_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Zfp420 PE=2 SV=1
15	Q8N7K0	571	673	0.514	0.440	ZN433_HUMAN Zinc finger protein 433 OS=Homo sapiens OX=9606 GN=ZNF433 PE=1 SV=1
16	Q8N8Z8	535	693	0.481	0.400	ZN441_HUMAN Zinc finger protein 441 OS=Homo sapiens OX=9606 GN=ZNF441 PE=1 SV=2
17	Q8NEP9	595	628	0.561	0.514	ZN555_HUMAN Zinc finger protein 555 OS=Homo sapiens OX=9606 GN=ZNF555 PE=1 SV=4
18	Q8TAQ5	533	688	0.479	0.401	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
19	Q8TBZ8	623	553	0.562	0.586	ZN564_HUMAN Zinc finger protein 564 OS=Homo sapiens OX=9606 GN=ZNF564 PE=1 SV=1
20	Q99PJ6	549	736	0.497	0.389	Q99PJ6_RAT RCG38839 OS=Rattus norvegicus OX=10116 GN=Zfp709 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07975 C1_4	0.024	26.2	TFIIH C1-like domain
2	PF19148 DUF5830	55	15.1	Family of unknown function (DUF5830)
3	PF01352 KRAB	3.6e-19	79.4	KRAB box
4	PF01286 XPA_N	0.022	26.1	XPA protein N-terminal
5	PF00096 zf-C2H2	2e-73	250.1	Zinc finger, C2H2 type
6	PF16622 zf-C2H2_11	4.4e-11	53.6	zinc-finger C2H2-type
7	PF13894 zf-C2H2_4	1.9e-60	207.2	C2H2-type zinc finger
8	PF13912 zf-C2H2_6	2.2e-29	112.0	C2H2-type zinc finger
9	PF12171 zf-C2H2_jaz	6.4e-20	82.2	Zinc-finger double-stranded RNA-binding
10	PF08996 zf-DNA_Pol	1.8e+02	13.2	DNA Polymerase alpha zinc finger
11	PF13465 zf-H2C2_2	3.2e-131	433.8	Zinc-finger double domain
12	PF12874 zf-met	40	16.0	Zinc-finger of C2H2 type
13	PF13451 zf-trcl	3.1e-11	54.3	Probable zinc-ribbon domain
14	PF18439 zf_UBZ	1.2e-06	39.4	Ubiquitin-Binding Zinc Finger
15	PF17032 zinc_ribbon_15	8.7	18.5	zinc-ribbon family
16	PF09723 Zn-ribbon_8	4.2e-15	66.9	Zinc ribbon domain
17	PF17283 Zn_ribbon_SprT	1.7e-16	71.2	SprT-like zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000342974

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000454038	0.550	GMP reductase 2
2	9606.ENSP00000259727	0.549	GMP reductase 1
3	9606.ENSP00000398089	0.535	Zinc finger protein 821
4	9606.ENSP00000370293	0.511	Checkpoint protein HUS1B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.915	regulation of biological process
GO:0009987	0.871	cellular process
GO:0050794	0.834	regulation of cellular process
GO:0019222	0.815	regulation of metabolic process
GO:0050896	0.781	response to stimulus
GO:0051171	0.664	regulation of nitrogen compound metabolic process
GO:0080090	0.657	regulation of primary metabolic process
GO:0031323	0.655	regulation of cellular metabolic process
GO:0060255	0.647	regulation of macromolecule metabolic process
GO:0051716	0.547	cellular response to stimulus
GO:0071704	0.469	organic substance metabolic process
GO:0019219	0.466	regulation of nucleobase-containing compound metabolic process
GO:0048519	0.460	negative regulation of biological process
GO:0044238	0.452	primary metabolic process
GO:0006950	0.440	response to stress
GO:0006807	0.410	nitrogen compound metabolic process
GO:0044237	0.402	cellular metabolic process
GO:0010556	0.365	regulation of macromolecule biosynthetic process
GO:0031326	0.365	regulation of cellular biosynthetic process
GO:0051252	0.365	regulation of RNA metabolic process
GO:0006355	0.357	regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0031981	0.977	nuclear lumen
GO:0005654	0.954	nucleoplasm
GO:0005829	0.842	cytosol
GO:0032991	0.374	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]