StarFunc result for job id Q3KQV9

User Input

>input (507 residues)
MASEQDVRARLQRAGQEHLLRFWAELAPEPRAALLAELALLEPEALREHCRRAAEACARP
HGPPPDLAARLRPLPPERVGRASRSDPETRRRWEEEGFRQISLNKVAVLLLAGGQGTRLG
VTYPKGMYRVGLPSRKTLYQLQAERIRRVEQLAGERHGTRCTVPWYVMTSEFTLGPTAEF
FREHNFFHLDPANVVMFEQRLLPAVTFDGKVILERKDKVAMAPDGNGGLYCALEDHKILE
DMERRGVEFVHVYCVDNILVRLADPVFIGFCVLQGADCGAKVVEKAYPEEPVGVVCQVDG
VPQVVEYSEISPETAQLRASDGSLLYNAGNICNHFFTRGFLKAVTREFEPLLKPHVAVKK
VPYVDEEGNLVKPLKPNGIKMEKFVFDVFRFAKNFAALEVLREEEFSPLKNAEPADRDSP
RTARQALLTQHYRWALRAGARFLDAHGAWLPELPSLPPNGDPPAICEISPLVSYSGEGLE
VYLQGREFQSPLILDEDQAREPQLQES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q16222	0.928	0.902	1.089E-78	522	0.574	0.557	Q16222.pdb.gz	UAP1_HUMAN UDP-N-acetylhexosamine pyrophosphorylase OS=Homo sapiens OX=9606 GN=UAP1 PE=1 SV=3
2	PDB:1jv1A	0.919	0.951	8.536E-76	490	0.574	0.594	1jv1A.pdb.gz	Crystal structures of two human pyrophosphorylase isoforms in complexes with UDPGlc(Gal)NAc: role of the alternatively spliced insert in the enzyme oligomeric assembly and active site architecture.
3	AFDB:Q8IGT8	0.912	0.863	1.289E-70	536	0.475	0.450	Q8IGT8.pdb.gz	Q8IGT8_DROME RE31673p (Fragment) OS=Drosophila melanogaster OX=7227 GN=mmy PE=2 SV=1
4	AFDB:O64765	0.866	0.874	1.714E-59	502	0.383	0.386	O64765.pdb.gz	UAP2_ARATH UDP-N-acetylglucosamine diphosphorylase 2 OS=Arabidopsis thaliana OX=3702 GN=GLCNAC1PUT2 PE=1 SV=1
5	AFDB:Q940S3	0.875	0.879	1.821E-59	505	0.379	0.380	Q940S3.pdb.gz	UAP1_ARATH UDP-N-acetylglucosamine diphosphorylase 1 OS=Arabidopsis thaliana OX=3702 GN=GLCNAC1PUT1 PE=1 SV=1
6	AFDB:A0A1D8PNG6	0.876	0.913	1.120E-58	486	0.351	0.366	A0A1D8PNG6.pdb.gz	A0A1D8PNG6_CANAL UDP-N-acetylglucosamine diphosphorylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UAP1 PE=4 SV=1
7	AFDB:P43123	0.870	0.923	6.888E-58	477	0.355	0.377	P43123.pdb.gz	UAP1_YEAST UDP-N-acetylglucosamine pyrophosphorylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=QRI1 PE=1 SV=1
8	AFDB:O94617	0.830	0.884	6.810E-51	475	0.333	0.356	O94617.pdb.gz	UAP1_SCHPO Probable UDP-N-acetylglucosamine pyrophosphorylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=uap1 PE=1 SV=1
9	AFDB:Q386Q8	0.793	0.741	1.093E-43	545	0.314	0.292	Q386Q8.pdb.gz	Q386Q8_TRYB2 UDP-N-acetylglucosamine pyrophosphorylase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0120 PE=1 SV=1
10	PDB:4bqhA	0.777	0.757	5.618E-42	521	0.308	0.299	4bqhA.pdb.gz	A Novel Allosteric Inhibitor of the Uridine Diphosphate N-Acetylglucosamine Pyrophosphorylase from Trypanosoma Brucei.
11	AFDB:Q9C5I1	0.750	0.629	5.823E-29	614	0.189	0.156	Q9C5I1.pdb.gz	USP_ARATH UDP-sugar pyrophosphorylase OS=Arabidopsis thaliana OX=3702 GN=USP PE=1 SV=1
12	AFDB:F4IY62	0.711	0.420	5.813E-28	883	0.174	0.100	F4IY62.pdb.gz	UGPA3_ARATH UTP--glucose-1-phosphate uridylyltransferase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=UGP3 PE=1 SV=1
13	PDB:2i5kB	0.558	0.603	1.274E-23	466	0.166	0.180	2i5kB.pdb.gz
14	PDB:2icyB	0.546	0.594	5.448E-23	463	0.160	0.175	2icyB.pdb.gz	Structure and Dynamics of UDP-Glucose Pyrophosphorylase from Arabidopsis thaliana with Bound UDP-Glucose and UTP.
15	PDB:4r7pA	0.599	0.623	8.829E-22	485	0.152	0.159	4r7pA.pdb.gz	A Quaternary Mechanism Enables the Complex Biological Functions of Octameric Human UDP-glucose Pyrophosphorylase, a Key Enzyme in Cell Metabolism.
16	PDB:3r2wC	0.520	0.578	7.809E-21	450	0.152	0.171	3r2wC.pdb.gz
17	PDB:3gueA	0.558	0.598	8.297E-21	468	0.142	0.154	3gueA.pdb.gz	Crystal Structure of UDP-glucose phosphorylase from Trypanosoma Brucei, (Tb10.389.0330)
18	PDB:4j18A	0.568	0.592	1.193E-20	485	0.150	0.157	4j18A.pdb.gz
19	PDB:3d8vA	0.413	0.435	3.286E-10	478	0.101	0.107	3d8vA.pdb.gz	Structure and function of GlmU from Mycobacterium tuberculosis.
20	PDB:2oi6B	0.399	0.442	4.180E-9	452	0.107	0.119	2oi6B.pdb.gz	Structure of the E. coli bifunctional GlmU acetyltransferase active site with substrates and products.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A140VKC0	0.0	607	505	0.578	0.580	A0A140VKC0_HUMAN Testis tissue sperm-binding protein Li 37a OS=Homo sapiens OX=9606 PE=2 SV=1
2	D3ZF39	0.0	603	521	0.588	0.572	D3ZF39_RAT UDP-N-acetylglucosamine pyrophosphorylase 1 OS=Rattus norvegicus OX=10116 GN=Uap1 PE=1 SV=2
3	Q16222	0.0	601	522	0.580	0.563	UAP1_HUMAN UDP-N-acetylhexosamine pyrophosphorylase OS=Homo sapiens OX=9606 GN=UAP1 PE=1 SV=3
4	Q9Y0Z0	2.72e-164	477	520	0.483	0.471	Q9Y0Z0_DROME LD24639p OS=Drosophila melanogaster OX=7227 GN=mmy PE=1 SV=1
5	Q8IPJ6	2.83e-164	476	483	0.483	0.507	Q8IPJ6_DROME Mummy, isoform B OS=Drosophila melanogaster OX=7227 GN=mmy PE=1 SV=1
6	Q8IGT8	1.94e-163	475	536	0.483	0.457	Q8IGT8_DROME RE31673p (Fragment) OS=Drosophila melanogaster OX=7227 GN=mmy PE=2 SV=1
7	O64765	2.96e-114	348	502	0.402	0.406	UAP2_ARATH UDP-N-acetylglucosamine diphosphorylase 2 OS=Arabidopsis thaliana OX=3702 GN=GLCNAC1PUT2 PE=1 SV=1
8	Q940S3	4.03e-108	333	505	0.389	0.390	UAP1_ARATH UDP-N-acetylglucosamine diphosphorylase 1 OS=Arabidopsis thaliana OX=3702 GN=GLCNAC1PUT1 PE=1 SV=1
9	A0A1D8PNG6	2.97e-106	327	486	0.363	0.379	A0A1D8PNG6_CANAL UDP-N-acetylglucosamine diphosphorylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UAP1 PE=4 SV=1
10	P43123	7.85e-105	323	477	0.371	0.394	UAP1_YEAST UDP-N-acetylglucosamine pyrophosphorylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=QRI1 PE=1 SV=1
11	O94617	6.86e-85	272	475	0.314	0.335	UAP1_SCHPO Probable UDP-N-acetylglucosamine pyrophosphorylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=uap1 PE=1 SV=1
12	Q386Q8	5.02e-65	222	545	0.325	0.303	Q386Q8_TRYB2 UDP-N-acetylglucosamine pyrophosphorylase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0120 PE=1 SV=1
13	Q54YZ0	1.53e-10	65.9	502	0.138	0.139	UGPA2_DICDI UTP--glucose-1-phosphate uridylyltransferase 2 OS=Dictyostelium discoideum OX=44689 GN=ugpB PE=2 SV=1
14	O59819	1.09e-09	63.2	499	0.114	0.116	UGPA2_SCHPO Probable UTP--glucose-1-phosphate uridylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC794.10 PE=3 SV=1
15	Q9C5I1	3.84e-09	61.6	614	0.160	0.132	USP_ARATH UDP-sugar pyrophosphorylase OS=Arabidopsis thaliana OX=3702 GN=USP PE=1 SV=1
16	P78811	1.97e-08	58.9	506	0.118	0.119	UGPA1_SCHPO Probable UTP--glucose-1-phosphate uridylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fyu1 PE=1 SV=2
17	Q9FHG3	3.80e-06	52.0	653	0.053	0.041	Q9FHG3_ARATH 16S rRNA processing protein RimM family OS=Arabidopsis thaliana OX=3702 GN=At5g46420 PE=1 SV=1
18	A0A8I6ANT4	7.44e-06	50.8	466	0.105	0.114	A0A8I6ANT4_RAT UTP--glucose-1-phosphate uridylyltransferase OS=Rattus norvegicus OX=10116 GN=Ugp2 PE=1 SV=1
19	Q4V8I9	7.85e-06	50.8	508	0.105	0.104	Q4V8I9_RAT UTP--glucose-1-phosphate uridylyltransferase OS=Rattus norvegicus OX=10116 GN=Ugp2 PE=1 SV=1
20	Q91ZJ5	8.06e-06	50.8	508	0.105	0.104	UGPA_MOUSE UTP--glucose-1-phosphate uridylyltransferase OS=Mus musculus OX=10090 GN=Ugp2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12804 NTP_transf_3	19	17.1	MobA-like NTP transferase domain
2	PF01704 UDPGP	8.6e-63	224.0	UTP--glucose-1-phosphate uridylyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386935

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000425809	0.993	Phosphoacetylglucosamine mutase
2	9606.ENSP00000379839	0.949	Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase
3	9606.ENSP00000328938	0.838	Kynurenine formamidase
4	9606.ENSP00000299299	0.835	Pterin-4-alpha-carbinolamine dehydratase
5	9606.ENSP00000216410	0.818	Glucosamine-phosphate N-acetyltransferase 1
6	9606.ENSP00000356903	0.806	UDP-N-acetylhexosamine pyrophosphorylase
7	9606.ENSP00000377036	0.750	Serine/threonine-protein phosphatase 2A activator
8	9606.ENSP00000219169	0.732	Nuclear transport factor 2
9	9606.ENSP00000379568	0.732	Acyl-CoA-binding domain-containing protein 5
10	9606.ENSP00000276590	0.730	Endoribonuclease LACTB2
11	9606.ENSP00000235345	0.681	UDP-glucuronic acid/UDP-N-acetylgalactosamine transporter
12	9606.ENSP00000345528	0.681	Solute carrier family 35 member F6
13	9606.ENSP00000285930	0.637	Aldose reductase
14	9606.ENSP00000360939	0.631	UMP-CMP kinase
15	9606.ENSP00000349860	0.624	Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1
16	9606.ENSP00000253778	0.623	Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2
17	9606.ENSP00000322991	0.617	Branched-chain-amino-acid aminotransferase, mitochondrial
18	9606.ENSP00000443459	0.617	Branched-chain-amino-acid aminotransferase, cytosolic
19	9606.ENSP00000291565	0.581	Pyridoxal kinase
20	9606.ENSP00000477639	0.578	N-acetyl-D-glucosamine kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003977	1.000	UDP-N-acetylglucosamine diphosphorylase activity
GO:0005488	0.995	binding
GO:0005515	0.992	protein binding
GO:0042802	0.558	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.998	cellular metabolic process
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:1901135	0.991	carbohydrate derivative metabolic process
GO:0044281	0.984	small molecule metabolic process
GO:1901360	0.934	organic cyclic compound metabolic process
GO:0034641	0.909	cellular nitrogen compound metabolic process
GO:0046483	0.896	heterocycle metabolic process
GO:0055086	0.891	nucleobase-containing small molecule metabolic process
GO:1901576	0.884	organic substance biosynthetic process
GO:0006793	0.871	phosphorus metabolic process
GO:0009225	0.828	nucleotide-sugar metabolic process
GO:0006040	0.622	amino sugar metabolic process
GO:1901564	0.408	organonitrogen compound metabolic process
GO:0044249	0.364	cellular biosynthetic process
GO:1901362	0.355	organic cyclic compound biosynthetic process
GO:0044271	0.331	cellular nitrogen compound biosynthetic process
GO:1901137	0.324	carbohydrate derivative biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0070013	0.987	intracellular organelle lumen
GO:0043227	0.980	membrane-bounded organelle
GO:0043231	0.956	intracellular membrane-bounded organelle
GO:0031981	0.948	nuclear lumen
GO:0016020	0.936	membrane
GO:0005886	0.911	plasma membrane
GO:0005654	0.881	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:13509	1.000	H(+) + N-acetyl-alpha-D-glucosamine 1-phosphate + UTP = diphosphate + UDP-N-acetyl-alpha-D-glucosamine
EC:2.7.7.23	1.000	UDP-N-acetylglucosamine diphosphorylase.

[back to server]