StarFunc result for job id Q3KR16

User Input

>input (790 residues)
MKAFGPPHEGPLQGLVASRIETYGGRHRASAQSTAGRLYPRGYPVLDPSRRRLQQYVPFA
RGSGQARGLSPMRLRDPEPEKRHGGHVGAGLLHSPKLKELTKAHELEVRLHTFSMFGMPR
LPPEDRRHWEIGEGGDSGLTIEKSWRELVPGHKEMSQELCHQQEALWELLTTELIYVRKL
KIMTDLLAAGLLNLQRVGLLMEVSAETLFGNVPSLIRTHRSFWDEVLGPTLEETRASGQP
LDPIGLQSGFLTFGQRFHPYVQYCLRVKQTMAYAREQQETNPLFHAFVQWCEKHKRSGRQ
MLCDLLIKPHQRITKYPLLLHAVLKRSPEARAQEALNAMIEAVESFLRHINGQVRQGEEQ
ESLAAAAQRIGPYEVLEPPSDEVEKNLRPFSTLDLTSPMLGVASEHTRQLLLEGPVRVKE
GREGKLDVYLFLFSDVLLVTKPQRKADKAKVIRPPLMLEKLVCQPLRDPNSFLLIHLTEF
QCVSSALLVHCPSPTDRAQWLEKTQQAQAALQKLKAEEYVQQKRELLTLYRDQDRESPST
RPSTPSLEGSQSSAEGRTPEFSTIIPHLVVTEDTDEDAPLVPDDTSDSGYGTLIPGTPTG
SRSPLSRLRQRALRRDPRLTFSTLELRDIPLRPHPPDPQAPQRRSAPELPEGILKGGSLP
QEDPPTWSEEEDGASERGNVVVETLHRARLRGQLPSSPTHADSAGESPWESSGEEEEEGP
LFLKAGHTSLRPMRAEDMLREIREELASQRIEGAEEPRDSRPRKLTRAQLQRMRGPHIIQ
LDTPLSASEV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2X0TW08	0.620	0.620	2.993E-99	790	1.000	1.000	A0A2X0TW08.pdb.gz	A0A2X0TW08_HUMAN PLEKHG6 (Fragment) OS=Homo sapiens OX=9606 GN=PLEKHG6 PE=4 SV=1
2	AFDB:F1R1Q2	0.543	0.375	4.944E-45	1157	0.316	0.216	F1R1Q2.pdb.gz	F1R1Q2_DANRE Pleckstrin homology domain-containing family G member 5 isoform X1 OS=Danio rerio OX=7955 GN=plekhg5a PE=4 SV=2
3	AFDB:A0A0G2L933	0.534	0.385	1.415E-44	1110	0.313	0.223	A0A0G2L933.pdb.gz	A0A0G2L933_DANRE Pleckstrin homology domain-containing family G member 5-like isoform X1 OS=Danio rerio OX=7955 GN=plekhg5b PE=4 SV=2
4	AFDB:Q22354	0.452	0.417	7.587E-29	862	0.215	0.197	Q22354.pdb.gz	Q22354_CAEEL DH domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rhgf-2 PE=1 SV=1
5	AFDB:P97433	0.339	0.168	3.396E-16	1693	0.141	0.066	P97433.pdb.gz	ARG28_MOUSE Rho guanine nucleotide exchange factor 28 OS=Mus musculus OX=10090 GN=Arhgef28 PE=1 SV=2
6	AFDB:E9Q7D5	0.367	0.190	9.696E-13	1581	0.133	0.066	E9Q7D5.pdb.gz	ARHG5_MOUSE Rho guanine nucleotide exchange factor 5 OS=Mus musculus OX=10090 GN=Arhgef5 PE=1 SV=1
7	PDB:7rx9A	0.221	0.393	9.781E-13	432	0.105	0.192	7rx9A.pdb.gz
8	AFDB:Q12774	0.366	0.188	2.906E-12	1597	0.125	0.062	Q12774.pdb.gz	ARHG5_HUMAN Rho guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=1 SV=3
9	AFDB:Q96DR7	0.345	0.316	5.265E-12	871	0.127	0.115	Q96DR7.pdb.gz	ARHGQ_HUMAN Rho guanine nucleotide exchange factor 26 OS=Homo sapiens OX=9606 GN=ARHGEF26 PE=1 SV=4
10	PDB:4mt6A	0.245	0.441	1.666E-11	389	0.075	0.152	4mt6A.pdb.gz
11	AFDB:Q1ZXH8	0.302	0.155	6.408E-10	1632	0.129	0.062	Q1ZXH8.pdb.gz	GXCDD_DICDI Guanine exchange factor for Rac 30 OS=Dictyostelium discoideum OX=44689 GN=gxcDD PE=4 SV=3
12	AFDB:A0A3B3IRZ4	0.162	0.112	2.375E-8	1222	0.144	0.093	A0A3B3IRZ4.pdb.gz	A0A3B3IRZ4_HUMAN IQ motif and Sec7 domain ArfGEF 1 OS=Homo sapiens OX=9606 GN=IQSEC1 PE=1 SV=1
13	PDB:4gouA	0.189	0.282	1.562E-7	507	0.066	0.103	4gouA.pdb.gz
14	PDB:6u3eA	0.121	0.217	2.697E-4	397	0.089	0.176	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
15	PDB:6hhgA	0.116	0.229	9.272E-4	386	0.025	0.052	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
16	PDB:6s9wA	0.118	0.219	1.465E-3	411	0.025	0.049	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
17	PDB:4mk0A	0.113	0.140	2.112E-3	631	0.038	0.048	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
18	PDB:6bbpA	0.120	0.159	2.536E-3	520	0.057	0.087	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
19	PDB:3ljuX	0.107	0.211	2.778E-3	373	0.034	0.072	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
20	PDB:3pvuA	0.105	0.133	3.045E-3	609	0.041	0.053	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2X0TW08	0.0	1593	790	1.000	1.000	A0A2X0TW08_HUMAN PLEKHG6 (Fragment) OS=Homo sapiens OX=9606 GN=PLEKHG6 PE=4 SV=1
2	F5H731	0.0	962	495	0.595	0.949	F5H731_HUMAN Pleckstrin homology and RhoGEF domain containing G6 OS=Homo sapiens OX=9606 GN=PLEKHG6 PE=1 SV=1
3	Q3KR16	0.0	1593	790	1.000	1.000	PKHG6_HUMAN Pleckstrin homology domain-containing family G member 6 OS=Homo sapiens OX=9606 GN=PLEKHG6 PE=1 SV=3
4	Q66T02	1.27e-124	401	1073	0.299	0.220	PKHG5_MOUSE Pleckstrin homology domain-containing family G member 5 OS=Mus musculus OX=10090 GN=Plekhg5 PE=1 SV=1
5	O94827	2.89e-123	396	1006	0.262	0.206	PKHG5_HUMAN Pleckstrin homology domain-containing family G member 5 OS=Homo sapiens OX=9606 GN=PLEKHG5 PE=1 SV=4
6	Q6RFZ7	3.68e-123	397	1039	0.257	0.195	PKHG5_RAT Pleckstrin homology domain-containing family G member 5 OS=Rattus norvegicus OX=10116 GN=Plekhg5 PE=1 SV=1
7	A0A0G2L933	7.29e-122	395	1110	0.254	0.181	A0A0G2L933_DANRE Pleckstrin homology domain-containing family G member 5-like isoform X1 OS=Danio rerio OX=7955 GN=plekhg5b PE=4 SV=2
8	A0A2R8RLU7	1.59e-121	393	1057	0.239	0.179	A0A2R8RLU7_DANRE Pleckstrin homology domain-containing family G member 5 isoform X4 OS=Danio rerio OX=7955 GN=plekhg5a PE=4 SV=1
9	A0A0R4ISX1	1.63e-120	392	1135	0.239	0.167	A0A0R4ISX1_DANRE Pleckstrin homology domain-containing family G member 5 isoform X3 OS=Danio rerio OX=7955 GN=plekhg5a PE=4 SV=1
10	F1R1Q2	2.12e-120	392	1157	0.239	0.163	F1R1Q2_DANRE Pleckstrin homology domain-containing family G member 5 isoform X1 OS=Danio rerio OX=7955 GN=plekhg5a PE=4 SV=2
11	M9PG56	8.26e-67	239	848	0.165	0.153	M9PG56_DROME Uncharacterized protein, isoform G OS=Drosophila melanogaster OX=7227 GN=CG13812 PE=1 SV=1
12	M9PFQ9	4.33e-66	241	1412	0.165	0.092	M9PFQ9_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=CG13811 PE=1 SV=1
13	B7Z086	4.59e-66	241	1445	0.165	0.090	B7Z086_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=CG7323 PE=1 SV=1
14	B7Z088	5.02e-66	241	1626	0.165	0.080	B7Z088_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=CG13811 PE=1 SV=1
15	B7Z087	5.12e-66	241	1480	0.165	0.088	B7Z087_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=CG13811 PE=1 SV=1
16	Q9VW85	7.04e-66	241	1661	0.165	0.078	Q9VW85_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=CG13812 PE=1 SV=4
17	Q22354	6.82e-55	206	862	0.151	0.138	Q22354_CAEEL DH domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rhgf-2 PE=1 SV=1
18	Q8SWY9	1.84e-31	130	469	0.094	0.158	Q8SWY9_DROME RH56938p OS=Drosophila melanogaster OX=7227 GN=CG42674 PE=2 SV=1
19	Q6ZR37	7.00e-29	125	691	0.133	0.152	PKHG7_HUMAN Pleckstrin homology domain-containing family G member 7 OS=Homo sapiens OX=9606 GN=PLEKHG7 PE=1 SV=2
20	Q61210	5.15e-18	91.7	920	0.110	0.095	ARHG1_MOUSE Rho guanine nucleotide exchange factor 1 OS=Mus musculus OX=10090 GN=Arhgef1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20320 DUF6615	92	13.9	Family of unknown function (DUF6615)
2	PF00169 PH	14	17.6	PH domain
3	PF15411 PH_10	2.7e+02	13.2	Pleckstrin homology domain
4	PF16652 PH_13	38	15.6	Pleckstrin homology domain
5	PF17838 PH_16	17	16.7	PH domain
6	PF15405 PH_5	3.2	19.3	Pleckstrin homology domain
7	PF00621 RhoGEF	7e-31	119.4	RhoGEF domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380185

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000400175	0.953	Transforming protein RhoA
2	9606.ENSP00000356042	0.798	Ezrin
3	9606.ENSP00000360540	0.691	Centrosomal protein of 55 kDa
4	9606.ENSP00000339467	0.675	Rho-related GTP-binding protein RhoG
5	9606.ENSP00000300093	0.668	Serine/threonine-protein kinase PLK1
6	9606.ENSP00000376753	0.610	PDZ domain-containing protein GIPC1
7	9606.ENSP00000340297	0.606	Rho guanine nucleotide exchange factor 10
8	9606.ENSP00000276282	0.559	Malignant fibrous histiocytoma amplified sequence 1
9	9606.ENSP00000285735	0.539	Rho-related GTP-binding protein RhoC
10	9606.ENSP00000297440	0.539	Dynein assembly factor 5, axonemal
11	9606.ENSP00000380942	0.528	Rho guanine nucleotide exchange factor 12
12	9606.ENSP00000262210	0.520	Centrosome and spindle pole-associated protein 1
13	9606.ENSP00000364886	0.507	Rho-related GTP-binding protein RhoE

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0023051	0.999	regulation of signaling
GO:0048583	0.996	regulation of response to stimulus
GO:0009966	0.990	regulation of signal transduction
GO:0051056	0.967	regulation of small GTPase mediated signal transduction
GO:0009987	0.831	cellular process
GO:0050896	0.439	response to stimulus
GO:0048518	0.371	positive regulation of biological process
GO:0048522	0.360	positive regulation of cellular process
GO:0051716	0.351	cellular response to stimulus
GO:0016043	0.330	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030054	1.000	cell junction
GO:0005813	0.996	centrosome
GO:0005829	0.988	cytosol
GO:0043227	0.705	membrane-bounded organelle
GO:0043231	0.670	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]