StarFunc result for job id Q3L8U1

User Input

>input (1400 residues)
MTDPMMDFFDDANLFGETLEGLSDDAFVQPGPVSLVDELNLGAEFEPLHIDSLNHVQGTP
THQKMTDFEQLNQFDSIKFHHVNQSFGSPAEHVLSPHSQFNCSPIHPQNQPNGLFPDVSD
GSPMWGHQTATTISNQNGSPFHQQGHSHSMHQNKSFVAHHDFALFQANEQQTQCTSLRSQ
QNRNNLNPGQNSLSQSKNFMNVSGPHRVNVNHPPQMTNASNSQQSISMQQFSQTSNPSAH
FHKCSSHQEGNFNGPSPNMTSCSVSNSQQFSSHYSFSSNHISPNSLLQSSAVLASNHTNQ
TLSDFTGSNSFSPHRGIKQESTQHILNPNTSLNSNNFQILHSSHPQGNYSNSKLSPVHMN
FPDPVDSGTQMGHFNDHVETNGFSSLEENLLHQVESQTEPFTGLDPEDLLQEGLLPHFDE
STFGQDNSSHILDHDLDRQFTSHLVTRPSDMAQTQLQSQARSWHSSFSNHQHLHDRNHLC
LQRQPPSSKKSDGSGTYTKLQNTQVRVMSEKKQRKKVESESKQEKANRIISEAIAKAKER
GERNIPRVMSPENFPTASVEGKEEKKGRRMKSKPKDKDSKKTKTCSKLKEKTKIGKLIIT
LGKKQKRKNESSDEISDAEQMPQHTLKDQDSQKRRSNRQIKRKKYAEDIEGKQSEEEVKG
SMKIKKNSAPLPGEQPLQLFVENPSEEDAAIVDKILSSRTVKKEISPGVMIDTEEFFVKY
KNYSYLHCEWATEEQLLKDKRIQQKIKRFKLRQAQRAHFFADMEEEPFNPDYVEVDRVLE
VSFCEDKDTGEPVIYYLVKWCSLPYEDSTWELKEDVDLAKIEEFEQLQASRPDTRRLDRP
PSNIWKKIDQSRDYKNGNQLREYQLEGLNWLLFNWYNRRNCILADEMGLGKTIQSITFLY
EILLTGIRGPFLIIAPLSTIANWEREFRTWTDINVVVYHGSLISRQMIQQYEMYFRDSQG
RIIRGAYRFQAIITTFEMILGGCGELNAIEWRCVIIDEAHRLKNKNCKLLEGLKLMNLEH
KVLLTGTPLQNTVEELFSLLHFLEPLRFPSESTFMQEFGDLKTEEQVQKLQAILKPMMLR
RLKEDVEKKLAPKEETIIEVELTNIQKKYYRAILEKNFSFLSKGAGQTNVPNLVNTMMEL
RKCCNHPYLIKGAEEKILGEFRDTYNPAASDFHLQAMIQSAGKLVLIDKLLPKMKAGGHK
VLIFSQMVRCLDILEDYLIHKRYLYERIDGRVRGNLRQAAIDRFSKPDSDRFVFLLCTRA
GGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQNKAVKVYRLVTRNSYEREMFDRA
SLKLGLDKAVLQSMSGRESNVGGIQQLSKKEIEDLLRRGAYGAIMEEEDEGSKFCEEDID
QILLRRTKTITIESEGRGST

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B0R0I6	0.510	0.288	0.000	2511	0.509	0.284	B0R0I6.pdb.gz	CHD8_DANRE Chromodomain-helicase-DNA-binding protein 8 OS=Danio rerio OX=7955 GN=chd8 PE=3 SV=2
2	AFDB:Q09XV5	0.533	0.298	0.000	2582	0.531	0.288	Q09XV5.pdb.gz	CHD8_MOUSE Chromodomain-helicase-DNA-binding protein 8 OS=Mus musculus OX=10090 GN=Chd8 PE=1 SV=1
3	AFDB:H3BSP3	0.042	0.085	1.730E-60	632	0.451	1.000	H3BSP3.pdb.gz	H3BSP3_HUMAN Chromodomain helicase DNA binding protein 9 (Fragment) OS=Homo sapiens OX=9606 GN=CHD9 PE=1 SV=1
4	PDB:6g0lM	0.380	0.608	3.162E-48	855	0.185	0.303	6g0lM.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
5	PDB:6g0lW	0.394	0.615	6.419E-47	878	0.187	0.298	6g0lW.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
6	PDB:6jylK	0.309	0.824	2.765E-41	504	0.162	0.450	6jylK.pdb.gz	Structures of the ISWI-nucleosome complex reveal a conserved mechanism of chromatin remodeling.
7	PDB:6tdaS	0.303	0.527	4.960E-36	783	0.151	0.269	6tdaS.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
8	PDB:7epuB	0.237	0.389	1.747E-35	748	0.148	0.277	7epuB.pdb.gz	Structural basis of ALC1/CHD1L autoinhibition and the mechanism of activation by the nucleosome.
9	PDB:7oo3b	0.285	0.710	3.190E-35	534	0.114	0.298	7oo3b.pdb.gz	Structural basis of human transcription-DNA repair coupling.
10	PDB:6uxwA	0.307	0.536	5.495E-34	778	0.149	0.269	6uxwA.pdb.gz	Cryo-EM structure of SWI/SNF complex bound to a nucleosome.
11	PDB:6kw3Y	0.305	0.730	5.784E-33	548	0.149	0.380	6kw3Y.pdb.gz	Structure of the RSC complex bound to the nucleosome.
12	AFDB:Q61687	0.284	0.164	1.404E-32	2476	0.189	0.107	Q61687.pdb.gz	ATRX_MOUSE Transcriptional regulator ATRX OS=Mus musculus OX=10090 GN=Atrx PE=1 SV=3
13	PDB:6gejM	0.289	0.567	2.809E-30	688	0.131	0.267	6gejM.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
14	PDB:5vvrM	0.263	0.679	2.241E-28	503	0.104	0.288	5vvrM.pdb.gz	Structural basis for the initiation of eukaryotic transcription-coupled DNA repair.
15	AFDB:F4HTG1	0.281	0.307	3.904E-27	1280	0.153	0.167	F4HTG1.pdb.gz	F4HTG1_ARATH SNF2 domain-containing protein / helicase domain-containing protein / zinc finger protein-like protein OS=Arabidopsis thaliana OX=3702 GN=EDA16 PE=1 SV=1
16	AFDB:O76743	0.198	0.234	1.450E-10	1156	0.123	0.149	O76743.pdb.gz	GLH4_CAEEL ATP-dependent RNA helicase glh-4 OS=Caenorhabditis elegans OX=6239 GN=glh-4 PE=1 SV=2
17	AFDB:O94875	0.036	0.042	3.396E-3	1100	0.086	0.110	O94875.pdb.gz	SRBS2_HUMAN Sorbin and SH3 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SORBS2 PE=1 SV=3
18	AFDB:Q10124	0.035	0.031	9.097E-3	1647	0.094	0.080	Q10124.pdb.gz	PQE1_CAEEL Putative RNA exonuclease pqe-1 OS=Caenorhabditis elegans OX=6239 GN=pqe-1 PE=2 SV=2
19	AFDB:E9Q842	0.070	0.048	3.204E-2	2432	0.115	0.066	E9Q842.pdb.gz	E9Q842_MOUSE Neuron navigator 2 OS=Mus musculus OX=10090 GN=Nav2 PE=1 SV=1
20	AFDB:Q54RP6	0.029	0.025	7.692E-2	1709	0.061	0.050	Q54RP6.pdb.gz	DHKL_DICDI Hybrid signal transduction histidine kinase L OS=Dictyostelium discoideum OX=44689 GN=dhkL PE=3 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8Y4P3	0.0	884	1102	0.325	0.413	A0A2R8Y4P3_HUMAN DNA helicase (Fragment) OS=Homo sapiens OX=9606 GN=CHD8 PE=1 SV=1
2	A0A2R8Y840	0.0	1340	1995	0.481	0.337	A0A2R8Y840_HUMAN DNA helicase (Fragment) OS=Homo sapiens OX=9606 GN=CHD8 PE=1 SV=1
3	A2AJK6	0.0	1258	2986	0.430	0.202	CHD7_MOUSE Chromodomain-helicase-DNA-binding protein 7 OS=Mus musculus OX=10090 GN=Chd7 PE=1 SV=1
4	B0R0I6	0.0	1294	2511	0.456	0.254	CHD8_DANRE Chromodomain-helicase-DNA-binding protein 8 OS=Danio rerio OX=7955 GN=chd8 PE=3 SV=2
5	B7Z002	0.0	1012	5517	0.330	0.084	B7Z002_DROME Kismet, isoform C OS=Drosophila melanogaster OX=7227 GN=kis PE=1 SV=1
6	H0YJG4	0.0	1025	1815	0.344	0.265	H0YJG4_HUMAN Chromodomain helicase DNA binding protein 8 (Fragment) OS=Homo sapiens OX=9606 GN=CHD8 PE=1 SV=2
7	H3BSP3	0.0	1307	632	0.451	1.000	H3BSP3_HUMAN Chromodomain helicase DNA binding protein 9 (Fragment) OS=Homo sapiens OX=9606 GN=CHD9 PE=1 SV=1
8	H3BTW3	0.0	1910	2424	0.654	0.378	H3BTW3_HUMAN DNA helicase OS=Homo sapiens OX=9606 GN=CHD9 PE=1 SV=9
9	M9NCY5	0.0	1010	5343	0.330	0.086	M9NCY5_DROME Kismet, isoform D OS=Drosophila melanogaster OX=7227 GN=kis PE=1 SV=1
10	M9NDB7	0.0	1011	5252	0.330	0.088	M9NDB7_DROME Kismet, isoform E OS=Drosophila melanogaster OX=7227 GN=kis PE=1 SV=1
11	M9NEL3	0.0	1010	5191	0.330	0.089	M9NEL3_DROME Kismet, isoform F OS=Drosophila melanogaster OX=7227 GN=kis PE=1 SV=1
12	Q09XV5	0.0	1348	2582	0.480	0.260	CHD8_MOUSE Chromodomain-helicase-DNA-binding protein 8 OS=Mus musculus OX=10090 GN=Chd8 PE=1 SV=1
13	Q3L8U1	0.0	2939	2897	1.000	0.483	CHD9_HUMAN Chromodomain-helicase-DNA-binding protein 9 OS=Homo sapiens OX=9606 GN=CHD9 PE=1 SV=2
14	Q54UZ8	0.0	714	2373	0.269	0.159	Q54UZ8_DICDI Myb domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0280705 PE=4 SV=1
15	Q8TD26	0.0	1217	2715	0.423	0.218	CHD6_HUMAN Chromodomain-helicase-DNA-binding protein 6 OS=Homo sapiens OX=9606 GN=CHD6 PE=1 SV=4
16	Q9HCK8	0.0	1343	2581	0.481	0.261	CHD8_HUMAN Chromodomain-helicase-DNA-binding protein 8 OS=Homo sapiens OX=9606 GN=CHD8 PE=1 SV=5
17	Q9JIX5	0.0	1348	2581	0.480	0.260	CHD8_RAT Chromodomain-helicase-DNA-binding protein 8 OS=Rattus norvegicus OX=10116 GN=Chd8 PE=1 SV=2
18	Q9P2D1	0.0	1248	2997	0.425	0.199	CHD7_HUMAN Chromodomain-helicase-DNA-binding protein 7 OS=Homo sapiens OX=9606 GN=CHD7 PE=1 SV=3
19	Q9VPL9	0.0	1011	5322	0.330	0.087	Q9VPL9_DROME FI24801p1 OS=Drosophila melanogaster OX=7227 GN=kis PE=1 SV=3
20	Q54CF8	3.97e-173	577	3071	0.214	0.097	Q54CF8_DICDI Chromo domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0293012 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00385 Chromo	6.1e-21	85.4	Chromo (CHRromatin Organisation MOdifier) domain
2	PF00270 DEAD	0.45	21.8	DEAD/DEAH box helicase
3	PF00271 Helicase_C	1.8e-14	65.4	Helicase conserved C-terminal domain
4	PF04851 ResIII	0.0045	28.5	Type III restriction enzyme, res subunit
5	PF00176 SNF2-rel_dom	3.2e-61	218.6	SNF2-related domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000457466

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363868	0.916	ATP-binding cassette sub-family A member 1
2	9606.ENSP00000360541	0.909	Carnitine O-palmitoyltransferase 2, mitochondrial
3	9606.ENSP00000252595	0.908	Long-chain fatty acid transport protein 1
4	9606.ENSP00000385523	0.907	Peroxisome proliferator-activated receptor alpha
5	9606.ENSP00000434516	0.906	Thioredoxin reductase 1, cytoplasmic
6	9606.ENSP00000217233	0.905	Tribbles homolog 3
7	9606.ENSP00000265723	0.905	Phosphatidylcholine translocator ABCB4
8	9606.ENSP00000287936	0.905	3-hydroxy-3-methylglutaryl-coenzyme A reductase
9	9606.ENSP00000338283	0.905	Neuronal PAS domain-containing protein 2
10	9606.ENSP00000346768	0.905	UDP-glucuronosyltransferase 1-9
11	9606.ENSP00000360762	0.905	Ankyrin repeat domain-containing protein 1
12	9606.ENSP00000222002	0.904	Bile salt sulfotransferase
13	9606.ENSP00000322229	0.903	Fatty acid desaturase 1
14	9606.ENSP00000236850	0.902	Apolipoprotein A-I
15	9606.ENSP00000301455	0.902	Angiopoietin-related protein 4
16	9606.ENSP00000386665	0.902	Four and a half LIM domains protein 2
17	9606.ENSP00000399421	0.902	Platelet glycoprotein 4
18	9606.ENSP00000266659	0.901	Glioma pathogenesis-related protein 1
19	9606.ENSP00000300056	0.901	Peroxisomal membrane protein 11A
20	9606.ENSP00000301645	0.901	Cholesterol 7-alpha-monooxygenase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0003682	0.959	chromatin binding
GO:0042393	0.795	histone binding
GO:1901363	0.753	heterocyclic compound binding
GO:0097159	0.738	organic cyclic compound binding
GO:0003824	0.671	catalytic activity
GO:0003676	0.654	nucleic acid binding
GO:0008094	0.595	ATP-dependent activity, acting on DNA
GO:0003677	0.561	DNA binding
GO:0140658	0.419	ATP-dependent chromatin remodeler activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.947	developmental process
GO:0009987	0.907	cellular process
GO:0050789	0.903	regulation of biological process
GO:0050794	0.883	regulation of cellular process
GO:0048856	0.863	anatomical structure development
GO:0019222	0.656	regulation of metabolic process
GO:0032501	0.624	multicellular organismal process
GO:0060255	0.581	regulation of macromolecule metabolic process
GO:0030154	0.531	cell differentiation
GO:0048468	0.518	cell development
GO:0007275	0.509	multicellular organism development
GO:0010468	0.498	regulation of gene expression
GO:0080090	0.391	regulation of primary metabolic process
GO:0031323	0.384	regulation of cellular metabolic process
GO:0051171	0.369	regulation of nitrogen compound metabolic process
GO:0019219	0.315	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.302	regulation of macromolecule biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.934	cytosol
GO:0043232	0.321	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]