StarFunc result for job id Q3LFD5

User Input

>input (358 residues)
MDGVLFRAHQCQYVHPCVHVYVTVGLMDPLCERKEKASKQERENPLAHLAAWGLVGLHNI
GQTCCLNSLIQVFVMNVDFARILKRITVPRGADEQRRSVPFQMLLLLEKMQDSRQKAVWP
LELAYCLQKYNVPLFVQHDAAQLYLKLWNLIKDQIADVHLVERLQALYMIRMKDSLICLD
CAMESSRNSSMLTLRLSFFDVDSKPLKTLEDALHCFFQPRELSSKSKCFCENCGKKTRGK
QVLKLTHLPQTLTIHLMRFSIRNSQTRKICHSLYFPQSLDFSQILPMKRESCDAEEQSGG
QYELFAVIAHVGMADSGHYCVYIRNAVDGKWFCFNDSNICLVSWEDIQCTYGNPNYHW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3LFD5	1.000	1.000	3.592E-75	358	1.000	1.000	Q3LFD5.pdb.gz
2	AFDB:Q9UMW8	0.854	0.822	8.387E-58	372	0.855	0.823	Q9UMW8.pdb.gz	UBP18_HUMAN Ubl carboxyl-terminal hydrolase 18 OS=Homo sapiens OX=9606 GN=USP18 PE=1 SV=1
3	AFDB:Q9WTV6	0.822	0.801	4.166E-49	368	0.645	0.628	Q9WTV6.pdb.gz	UBP18_MOUSE Ubl carboxyl-terminal hydrolase 18 OS=Mus musculus OX=10090 GN=Usp18 PE=1 SV=2
4	AFDB:E7EYZ1	0.773	0.820	1.555E-27	337	0.260	0.276	E7EYZ1.pdb.gz	E7EYZ1_DANRE Ubiquitin-specific peptidase 18 OS=Danio rerio OX=7955 GN=usp18 PE=4 SV=1
5	AFDB:Q8BY87	0.768	0.208	3.847E-26	1376	0.285	0.074	Q8BY87.pdb.gz	UBP47_MOUSE Ubiquitin carboxyl-terminal hydrolase 47 OS=Mus musculus OX=10090 GN=Usp47 PE=1 SV=2
6	AFDB:Q24574	0.748	0.182	3.716E-25	1556	0.285	0.066	Q24574.pdb.gz	UBPE_DROME Ubiquitin carboxyl-terminal hydrolase 47 OS=Drosophila melanogaster OX=7227 GN=Usp47 PE=1 SV=2
7	AFDB:Q70EK9	0.753	0.392	5.905E-24	711	0.229	0.115	Q70EK9.pdb.gz	UBP51_HUMAN Ubiquitin carboxyl-terminal hydrolase 51 OS=Homo sapiens OX=9606 GN=USP51 PE=1 SV=1
8	AFDB:A6NNY8	0.734	0.606	7.367E-24	438	0.223	0.183	A6NNY8.pdb.gz	UBP27_HUMAN Ubiquitin carboxyl-terminal hydrolase 27 OS=Homo sapiens OX=9606 GN=USP27X PE=1 SV=3
9	AFDB:Q6P8X6	0.716	0.660	9.192E-24	390	0.207	0.190	Q6P8X6.pdb.gz	UBP50_MOUSE Putative ubiquitin carboxyl-terminal hydrolase 50 OS=Mus musculus OX=10090 GN=Usp50 PE=2 SV=1
10	AFDB:Q22240	0.756	0.219	1.085E-23	1326	0.282	0.076	Q22240.pdb.gz	Q22240_CAEEL Ubiquitin carboxyl-terminal hydrolase 47 OS=Caenorhabditis elegans OX=6239 GN=CELE_T05H10.1 PE=1 SV=2
11	PDB:5cvnB	0.712	0.790	1.284E-20	321	0.201	0.224	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
12	PDB:3mhsA	0.677	0.541	3.357E-19	455	0.204	0.160	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
13	PDB:5k16B	0.653	0.708	3.548E-19	328	0.196	0.213	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
14	PDB:7yxxA	0.681	0.152	1.015E-18	1754	0.221	0.045	7yxxA.pdb.gz
15	PDB:8a9kD	0.625	0.775	5.048E-18	285	0.190	0.239	8a9kD.pdb.gz	Cryo-EM reveals a mechanism of USP1 inhibition through a cryptic binding site.
16	PDB:7w3ax	0.708	0.524	1.904E-17	494	0.196	0.142	7w3ax.pdb.gz	USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.
17	PDB:5gjqx	0.690	0.696	1.001E-16	355	0.190	0.192	5gjqx.pdb.gz	An atomic structure of the human 26S proteasome.
18	PDB:7ay1D	0.687	0.719	2.563E-16	341	0.212	0.223	7ay1D.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
19	PDB:3ihpB	0.673	0.362	5.875E-16	681	0.179	0.094	3ihpB.pdb.gz	Covalent Ubiquitin-Usp5 Complex
20	PDB:7qo48	0.656	0.632	1.274E-15	372	0.212	0.204	7qo48.pdb.gz	Allosteric control of Ubp6 and the proteasome via a bidirectional switch.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UMW8	0.0	631	372	0.855	0.823	UBP18_HUMAN Ubl carboxyl-terminal hydrolase 18 OS=Homo sapiens OX=9606 GN=USP18 PE=1 SV=1
2	Q9WTV6	1.00e-167	474	368	0.642	0.625	UBP18_MOUSE Ubl carboxyl-terminal hydrolase 18 OS=Mus musculus OX=10090 GN=Usp18 PE=1 SV=2
3	E7EYZ1	9.30e-42	150	337	0.254	0.270	E7EYZ1_DANRE Ubiquitin-specific peptidase 18 OS=Danio rerio OX=7955 GN=usp18 PE=4 SV=1
4	Q8BY87	9.98e-35	137	1376	0.265	0.069	UBP47_MOUSE Ubiquitin carboxyl-terminal hydrolase 47 OS=Mus musculus OX=10090 GN=Usp47 PE=1 SV=2
5	Q96K76	2.07e-34	136	1375	0.260	0.068	UBP47_HUMAN Ubiquitin carboxyl-terminal hydrolase 47 OS=Homo sapiens OX=9606 GN=USP47 PE=1 SV=3
6	A0A0R4IB93	9.79e-27	114	1047	0.249	0.085	UBP48_DANRE Ubiquitin carboxyl-terminal hydrolase 48 OS=Danio rerio OX=7955 GN=usp48 PE=3 SV=1
7	Q24574	1.45e-24	107	1556	0.223	0.051	UBPE_DROME Ubiquitin carboxyl-terminal hydrolase 47 OS=Drosophila melanogaster OX=7227 GN=Usp47 PE=1 SV=2
8	Q22240	2.41e-24	107	1326	0.268	0.072	Q22240_CAEEL Ubiquitin carboxyl-terminal hydrolase 47 OS=Caenorhabditis elegans OX=6239 GN=CELE_T05H10.1 PE=1 SV=2
9	Q9UTT1	3.72e-23	103	1129	0.229	0.073	UBP71_SCHPO Ubiquitin carboxyl-terminal hydrolase 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp15 PE=1 SV=2
10	Q86UV5	4.48e-23	103	1035	0.257	0.089	UBP48_HUMAN Ubiquitin carboxyl-terminal hydrolase 48 OS=Homo sapiens OX=9606 GN=USP48 PE=1 SV=1
11	Q76LT8	6.74e-23	102	1036	0.243	0.084	UBP48_RAT Ubiquitin carboxyl-terminal hydrolase 48 OS=Rattus norvegicus OX=10116 GN=Usp48 PE=1 SV=1
12	Q09879	5.66e-22	99.8	1108	0.212	0.069	UBP72_SCHPO Ubiquitin carboxyl-terminal hydrolase 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp5 PE=1 SV=3
13	Q9UPU5	5.76e-21	97.1	2620	0.240	0.033	UBP24_HUMAN Ubiquitin carboxyl-terminal hydrolase 24 OS=Homo sapiens OX=9606 GN=USP24 PE=1 SV=3
14	P50101	1.40e-20	95.5	1230	0.204	0.059	UBP15_YEAST Ubiquitin carboxyl-terminal hydrolase 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBP15 PE=1 SV=1
15	Q6A4J8	2.76e-20	94.7	1103	0.240	0.078	UBP7_MOUSE Ubiquitin carboxyl-terminal hydrolase 7 OS=Mus musculus OX=10090 GN=Usp7 PE=1 SV=1
16	Q93009	1.09e-19	92.8	1102	0.237	0.077	UBP7_HUMAN Ubiquitin carboxyl-terminal hydrolase 7 OS=Homo sapiens OX=9606 GN=USP7 PE=1 SV=2
17	Q4VSI4	1.13e-19	92.8	1103	0.237	0.077	UBP7_RAT Ubiquitin carboxyl-terminal hydrolase 7 OS=Rattus norvegicus OX=10116 GN=Usp7 PE=1 SV=1
18	Q9VYQ8	1.69e-19	92.4	1129	0.212	0.067	UBP7_DROME Ubiquitin carboxyl-terminal hydrolase 7 OS=Drosophila melanogaster OX=7227 GN=Usp7 PE=1 SV=1
19	G3MU83	4.25e-19	91.3	1134	0.232	0.073	G3MU83_CAEEL Ubiquitin carboxyl-terminal hydrolase 7 OS=Caenorhabditis elegans OX=6239 GN=math-33 PE=1 SV=1
20	G3MU81	4.29e-19	91.3	1129	0.232	0.074	G3MU81_CAEEL Ubiquitin carboxyl-terminal hydrolase 7 OS=Caenorhabditis elegans OX=6239 GN=math-33 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00443 UCH	1.1e-34	131.8	Ubiquitin carboxyl-terminal hydrolase
2	PF13423 UCH_1	8.9e-14	63.4	Ubiquitin carboxyl-terminal hydrolase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000414922

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368699	0.969	Ubiquitin-like protein ISG15
2	9606.ENSP00000381601	0.958	Interferon-induced GTP-binding protein Mx1
3	9606.ENSP00000333657	0.956	Interferon-induced GTP-binding protein Mx2
4	9606.ENSP00000360869	0.954	Interferon-induced protein with tetratricopeptide repeats 1
5	9606.ENSP00000369213	0.947	Probable ATP-dependent RNA helicase DDX58
6	9606.ENSP00000354394	0.944	Signal transducer and activator of transcription 1-alpha/beta
7	9606.ENSP00000233057	0.929	Interferon-induced, double-stranded RNA-activated protein kinase
8	9606.ENSP00000303709	0.918	Ubiquitin-conjugating enzyme E2 E1
9	9606.ENSP00000343204	0.917	Tyrosine-protein kinase JAK1
10	9606.ENSP00000263025	0.904	Mitogen-activated protein kinase 3
11	9606.ENSP00000244007	0.902	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
12	9606.ENSP00000371471	0.729	Radical S-adenosyl methionine domain-containing protein 2
13	9606.ENSP00000215794	0.701	Ubl carboxyl-terminal hydrolase 18
14	9606.ENSP00000380697	0.689	Interferon regulatory factor 7
15	9606.ENSP00000353512	0.664	Poly [ADP-ribose] polymerase 9
16	9606.ENSP00000484883	0.636	Putative uncharacterized protein C10orf126
17	9606.ENSP00000333266	0.630	Ubiquitin-like modifier-activating enzyme 7
18	9606.ENSP00000379412	0.620	Zinc finger NFX1-type containing 1
19	9606.ENSP00000360874	0.614	Interferon induced protein with tetratricopeptide repeats 1B
20	9606.ENSP00000464087	0.595	E3 ubiquitin-protein ligase RNF213

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004843	0.999	cysteine-type deubiquitinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.991	organic substance metabolic process
GO:0044238	0.991	primary metabolic process
GO:0006807	0.987	nitrogen compound metabolic process
GO:0050789	0.983	regulation of biological process
GO:0070647	0.976	protein modification by small protein conjugation or removal
GO:0070646	0.965	protein modification by small protein removal
GO:0016579	0.958	protein deubiquitination
GO:0050794	0.933	regulation of cellular process
GO:0048519	0.851	negative regulation of biological process
GO:0048583	0.809	regulation of response to stimulus
GO:0032101	0.708	regulation of response to external stimulus
GO:0048585	0.696	negative regulation of response to stimulus
GO:0050896	0.688	response to stimulus
GO:0031347	0.607	regulation of defense response
GO:0048523	0.602	negative regulation of cellular process
GO:0023051	0.507	regulation of signaling
GO:0010646	0.433	regulation of cell communication
GO:0009966	0.409	regulation of signal transduction
GO:0045088	0.400	regulation of innate immune response
GO:0060759	0.377	regulation of response to cytokine stimulus
GO:0031348	0.361	negative regulation of defense response
GO:0032102	0.360	negative regulation of response to external stimulus
GO:0002683	0.356	negative regulation of immune system process
GO:0002832	0.323	negative regulation of response to biotic stimulus
GO:0060761	0.317	negative regulation of response to cytokine stimulus
GO:0001959	0.316	regulation of cytokine-mediated signaling pathway
GO:0044419	0.312	biological process involved in interspecies interaction between organisms
GO:0009968	0.305	negative regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0005829	0.992	cytosol
GO:0070013	0.657	intracellular organelle lumen
GO:0031981	0.467	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	0.999	ubiquitinyl hydrolase 1.

[back to server]