StarFunc result for job id Q3MIP1

User Input

>input (535 residues)
MSVHYTLNLRVFWPLVTGLCTALVCLYHVLRGSGGARAEPADGVDGGFPLLKVAVLLLLS
YVLLRCRHAVRQRFLPGSPRLEGHAAFSSRHFREPGLSILLESYYEHEVRLSPHVLGHSK
AHVSRIVGELVRAGRARGSPGLIPGGALALAFRGDFIQVGSAYEQHKIRRPDSFDVLVPL
RLPPLVALEPRSLGEEPALAPAFRGCFLCALKAPPSPSGASGGHWLRDCKPFADAFCVDV
RGRRHLSATLVLRWFQSHLQRSLATVRYSLEGRCRVTLTPGGLEQPPTLHILPCRTDYGC
CRLSMAVRLIPAVHLGDGVFLVAPPPPPLPSAPLLELPEGLRAEALWGVNTARQEQKLLS
WLQERAAPGACYLKCLQLLKALRDLGARGLDSAAATQWGRILSSYVLKTVLLAVLLRKGA
PGQGWDEEHLGRCLEELVQFLRDCLLRRHTLFHCVLGPGGAAAEVGPLPKALREAAPVDL
LAAFDGHARELAAARLLSTWQRLPQLLRAYGGPRYLARCPPPRSQRTQGFLEGEP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3TNL8	0.625	0.604	3.254E-22	555	0.224	0.216	Q3TNL8.pdb.gz	IPRI_MOUSE Inositol 1,4,5-trisphosphate receptor-interacting protein OS=Mus musculus OX=10090 GN=Itprip PE=1 SV=1
2	AFDB:Q6GPH6	0.573	0.554	5.718E-21	555	0.204	0.196	Q6GPH6.pdb.gz	IPIL1_HUMAN Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1 OS=Homo sapiens OX=9606 GN=ITPRIPL1 PE=1 SV=1
3	AFDB:Q8IWB1	0.608	0.596	6.992E-21	547	0.207	0.203	Q8IWB1.pdb.gz	IPRI_HUMAN Inositol 1,4,5-trisphosphate receptor-interacting protein OS=Homo sapiens OX=9606 GN=ITPRIP PE=1 SV=1
4	AFDB:A7SFB5	0.544	0.676	6.208E-18	422	0.178	0.225	A7SFB5.pdb.gz	CGAS_NEMVE Cyclic GMP-AMP synthase OS=Nematostella vectensis OX=45351 GN=v1g211400 PE=1 SV=1
5	AFDB:Q5XIS8	0.511	0.582	1.060E-14	463	0.196	0.227	Q5XIS8.pdb.gz	MID51_RAT Mitochondrial dynamics protein MID51 OS=Rattus norvegicus OX=10116 GN=Mief1 PE=1 SV=1
6	AFDB:Q5NCS9	0.514	0.596	6.616E-12	454	0.179	0.211	Q5NCS9.pdb.gz	MID49_MOUSE Mitochondrial dynamics protein MID49 OS=Mus musculus OX=10090 GN=Mief2 PE=1 SV=1
7	PDB:7buqA	0.474	0.677	3.086E-11	362	0.150	0.221	7buqA.pdb.gz	Mn2+Directly Activates cGAS and Structural Analysis Suggests Mn2+Induces a Noncanonical Catalytic Synthesis of 2'3'-cGAMP.
8	PDB:7lt2A	0.472	0.629	6.562E-11	387	0.138	0.191	7lt2A.pdb.gz	cGAS-like receptors sense RNA and control 3'2'-cGAMP signalling in Drosophila.
9	PDB:5eomC	0.390	0.548	6.632E-10	353	0.133	0.201	5eomC.pdb.gz	Structural and biochemical characterization of the cell fate determining nucleotidyltransferase fold protein MAB21L1.
10	PDB:5eogF	0.363	0.539	1.108E-8	330	0.142	0.230	5eogF.pdb.gz
11	PDB:7lt1A	0.436	0.556	8.284E-8	403	0.131	0.174	7lt1A.pdb.gz
12	PDB:5eomJ	0.329	0.562	3.825E-5	286	0.127	0.238	5eomJ.pdb.gz	Structural and biochemical characterization of the cell fate determining nucleotidyltransferase fold protein MAB21L1.
13	PDB:4rwnA	0.286	0.414	1.729E-4	349	0.116	0.178	4rwnA.pdb.gz	The Activation Mechanism of 2'-5'-Oligoadenylate Synthetase Gives New Insights Into OAS/cGAS Triggers of Innate Immunity.
14	PDB:4xj6A	0.347	0.474	1.729E-4	370	0.110	0.159	4xj6A.pdb.gz	Structural Basis for the Catalytic Mechanism of DncV, Bacterial Homolog of Cyclic GMP-AMP Synthase
15	PDB:5wyjCB	0.352	0.190	2.459E-4	1098	0.108	0.053	5wyjCB.pdb.gz	Molecular architecture of the 90S small subunit pre-ribosome.
16	PDB:4atbA	0.355	0.535	4.971E-4	334	0.112	0.180	4atbA.pdb.gz	NF45 Dimerizes with NF90, Zfr and Spnr Via a Conserved Domain that Has a Nucleotidyltransferase Fold.
17	AFDB:Q9VYS4	0.287	0.138	2.976E-2	1373	0.120	0.047	Q9VYS4.pdb.gz	GLD2B_DROME Poly(A) RNA polymerase gld-2 homolog B OS=Drosophila melanogaster OX=7227 GN=wisp PE=1 SV=1
18	AFDB:A1Z6M8	0.097	0.089	4.067E-1	614	0.138	0.121	A1Z6M8.pdb.gz	A1Z6M8_DROME heparosan-N-sulfate-glucuronate 5-epimerase OS=Drosophila melanogaster OX=7227 GN=Hsepi PE=3 SV=1
19	AFDB:Q38EI4	0.195	0.071	6.395E-1	1857	0.093	0.027	Q38EI4.pdb.gz	Q38EI4_TRYB2 Polymerase nucleotidyl transferase domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.5640 PE=4 SV=1
20	AFDB:Q4GYM8	0.083	0.060	9.093E-1	791	0.099	0.067	Q4GYM8.pdb.gz	Q4GYM8_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.3450 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3TNL8	3.09e-11	68.2	555	0.198	0.191	IPRI_MOUSE Inositol 1,4,5-trisphosphate receptor-interacting protein OS=Mus musculus OX=10090 GN=Itprip PE=1 SV=1
2	Q6GPH6	1.69e-10	65.9	555	0.185	0.178	IPIL1_HUMAN Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1 OS=Homo sapiens OX=9606 GN=ITPRIPL1 PE=1 SV=1
3	Q8IWB1	4.53e-07	55.1	547	0.131	0.128	IPRI_HUMAN Inositol 1,4,5-trisphosphate receptor-interacting protein OS=Homo sapiens OX=9606 GN=ITPRIP PE=1 SV=1
4	A7SFB5	3.16e-04	45.8	422	0.136	0.173	CGAS_NEMVE Cyclic GMP-AMP synthase OS=Nematostella vectensis OX=45351 GN=v1g211400 PE=1 SV=1
5	Q8N884	0.20	37.0	522	0.047	0.048	CGAS_HUMAN Cyclic GMP-AMP synthase OS=Homo sapiens OX=9606 GN=CGAS PE=1 SV=2
6	M9MSK7	0.73	35.4	1509	0.067	0.024	M9MSK7_DROME Formin homology 2 domain containing, isoform D OS=Drosophila melanogaster OX=7227 GN=Fhos PE=4 SV=1
7	Q99LB7	0.75	35.0	919	0.080	0.047	SARDH_MOUSE Sarcosine dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Sardh PE=1 SV=1
8	Q8SY43	0.82	35.0	1294	0.067	0.028	Q8SY43_DROME LD24110p OS=Drosophila melanogaster OX=7227 GN=Fhos PE=2 SV=1
9	Q9VSQ0	0.82	35.0	1294	0.067	0.028	Q9VSQ0_DROME FI03664p OS=Drosophila melanogaster OX=7227 GN=Fhos PE=2 SV=2
10	M9ND66	0.94	35.0	1744	0.065	0.020	M9ND66_DROME Formin homology 2 domain containing, isoform H OS=Drosophila melanogaster OX=7227 GN=Fhos PE=4 SV=1
11	M9MRS9	0.96	35.0	1387	0.067	0.026	M9MRS9_DROME Formin homology 2 domain containing, isoform E OS=Drosophila melanogaster OX=7227 GN=Fhos PE=4 SV=1
12	M9NE63	1.0	34.7	1205	0.067	0.030	M9NE63_DROME Formin homology 2 domain containing, isoform F OS=Drosophila melanogaster OX=7227 GN=Fhos PE=4 SV=1
13	Q9VSQ1	1.00	34.7	1393	0.067	0.026	Q9VSQ1_DROME Formin homology 2 domain containing, isoform A OS=Drosophila melanogaster OX=7227 GN=Fhos PE=4 SV=2
14	Q8T4F5	1.1	34.7	1211	0.067	0.030	Q8T4F5_DROME SD08909p OS=Drosophila melanogaster OX=7227 GN=Fhos PE=2 SV=1
15	Q8C6L5	1.3	34.3	507	0.041	0.043	CGAS_MOUSE Cyclic GMP-AMP synthase OS=Mus musculus OX=10090 GN=Cgas PE=1 SV=1
16	Q57V61	1.5	33.9	347	0.024	0.037	Q57V61_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.3K10.280 PE=4 SV=1
17	M9NFP9	1.6	34.3	1152	0.067	0.031	M9NFP9_DROME Formin homology 2 domain containing, isoform G OS=Drosophila melanogaster OX=7227 GN=Fhos PE=4 SV=1
18	O70299	1.6	33.9	359	0.054	0.081	MB211_MOUSE Putative nucleotidyltransferase MAB21L1 OS=Mus musculus OX=10090 GN=Mab21l1 PE=2 SV=1
19	Q13394	1.6	33.9	359	0.054	0.081	MB211_HUMAN Putative nucleotidyltransferase MAB21L1 OS=Homo sapiens OX=9606 GN=MAB21L1 PE=1 SV=1
20	E1JI78	1.7	33.9	2528	0.065	0.014	E1JI78_DROME Formin homology 2 domain containing, isoform I OS=Drosophila melanogaster OX=7227 GN=Fhos PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03281 Mab-21	1.4	20.5	Mab-21 protein nucleotidyltransferase domain
2	PF20266 Mab-21_C	0.00084	30.8	Mab-21 protein HhH/H2TH-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370849

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376246	0.753	Protein MB21D2
2	9606.ENSP00000297990	0.671	Nucleolar protein 6
3	9606.ENSP00000443410	0.655	Putative nucleotidyltransferase FAM46D
4	9606.ENSP00000379057	0.649	Mitochondrial dynamics protein MID49
5	9606.ENSP00000327124	0.637	Mitochondrial dynamics protein MID51
6	9606.ENSP00000238714	0.619	Poly(A) polymerase gamma
7	9606.ENSP00000415968	0.617	Spermatid perinuclear RNA-binding protein
8	9606.ENSP00000359181	0.603	DNA polymerase lambda
9	9606.ENSP00000216277	0.602	Poly(A) polymerase alpha
10	9606.ENSP00000358458	0.595	Putative nucleotidyltransferase FAM46C
11	9606.ENSP00000398596	0.590	Phosphatidate cytidylyltransferase, mitochondrial
12	9606.ENSP00000265069	0.559	Zinc finger RNA-binding protein
13	9606.ENSP00000297135	0.541	Conserved oligomeric Golgi complex subunit 5
14	9606.ENSP00000396995	0.522	Non-canonical poly(A) RNA polymerase PAPD5
15	9606.ENSP00000358512	0.515	Protein mab-21-like 3
16	9606.ENSP00000308000	0.514	Speckle targeted PIP5K1A-regulated poly(A) polymerase
17	9606.ENSP00000315387	0.514	Transmembrane protein 102
18	9606.ENSP00000352172	0.508	V-set and immunoglobulin domain containing 10
19	9606.ENSP00000373586	0.503	Uncharacterized protein C2orf54

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.761	catalytic activity
GO:0016779	0.672	nucleotidyltransferase activity
GO:1901363	0.618	heterocyclic compound binding
GO:0097159	0.618	organic cyclic compound binding
GO:0003676	0.550	nucleic acid binding
GO:0003723	0.360	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0009987	0.982	cellular process
GO:0048518	0.926	positive regulation of biological process
GO:0048522	0.716	positive regulation of cellular process
GO:0050896	0.345	response to stimulus
GO:0019222	0.329	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0016020	0.991	membrane
GO:0043231	0.986	intracellular membrane-bounded organelle
GO:0005737	0.969	cytoplasm
GO:0070013	0.942	intracellular organelle lumen
GO:0005634	0.934	nucleus
GO:0031981	0.755	nuclear lumen
GO:0032991	0.573	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.7.-	0.672	Nucleotidyltransferases.

[back to server]