StarFunc result for job id Q3MIS6

User Input

>input (628 residues)
MALTQGPLKFMDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLGICLPDLSVTSML
EQKRDPWTLQSEEKIANDPDGRECIKGVNTERSSKLGSNAGNKPCKNQLGFTFQLHLSDL
QLFQAERKISGCKHFEKPVSDNSSVSPLEKISSSVKSHLLNKYRNNFDHAPLLPQEQKAH
IREKAYKCNEHGQVFRASASLTNQVIHNADNPYKCSECGKVFSCSSKLVIHRRMHTGEKP
YKCHECGKLFSSNSNLSQHQRIHTGEKPYKCHECDKVFRSSSKLAQHQRIHTGEKPYKCH
ECDKVFNQIAHLVRHQKIHTGEKPYSCNKCGKVFSRHSYLAEHQTVHTGEKPYKCEECGK
AFSVRSSLITHQLIHTGRKPYKCKECDKVFGRKCFLTSHQRIHTRERPYGCSQCGKIFSQ
KSDLIRHRKTHTDEKPYKCNKCGTAFREFSDLTAHFLIHSGEKPYECKECGKVFRYKSSL
TSHHRIHTGEKPYKCNRCGKVFSRSSNLVCHQKIHTGEKPYKCNQCGKVFNQASYLTRHQ
IIHTGERPYRCSKCGKAFRGCSGLTAHLAIHTEKKSHECKECGKIFTQKSSLTNHHRIHI
GEKPYKCTLCSKVFSHNSDLAQHQRVHS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q06732	0.558	0.464	1.387E-60	778	0.471	0.380	Q06732.pdb.gz	ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens OX=9606 GN=ZNF33B PE=1 SV=2
2	AFDB:Q6ECI4	0.579	0.514	9.206E-60	717	0.459	0.402	Q6ECI4.pdb.gz	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
3	AFDB:Q9BX82	0.550	0.551	4.922E-59	626	0.451	0.452	Q9BX82.pdb.gz	ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens OX=9606 GN=ZNF471 PE=2 SV=1
4	AFDB:Q62788	0.316	0.273	6.450E-59	744	0.452	0.382	Q62788.pdb.gz	Q62788_RAT Cys2/His2 zinc finger protein OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=2 SV=1
5	AFDB:Q8WV37	0.371	0.425	1.902E-58	535	0.530	0.622	Q8WV37.pdb.gz	ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens OX=9606 GN=ZNF480 PE=1 SV=2
6	AFDB:Q14587	0.539	0.376	2.237E-58	947	0.459	0.304	Q14587.pdb.gz	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
7	AFDB:Q5MCW4	0.613	0.564	2.932E-58	686	0.497	0.455	Q5MCW4.pdb.gz	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
8	AFDB:P51523	0.619	0.532	4.770E-58	738	0.468	0.398	P51523.pdb.gz	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
9	AFDB:P17014	0.574	0.522	1.263E-57	697	0.475	0.428	P17014.pdb.gz	ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens OX=9606 GN=ZNF12 PE=1 SV=3
10	AFDB:A0A024R4S7	0.571	0.460	1.568E-57	792	0.475	0.376	A0A024R4S7.pdb.gz
11	PDB:3w5kB	0.083	0.256	4.140E-4	110	0.057	0.327	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:7ena4	0.062	0.078	3.036E-1	457	0.083	0.114	7ena4.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
13	PDB:4kfzB	0.049	0.148	3.769E-1	148	0.043	0.182	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
14	PDB:5dkaA	0.046	0.163	5.214E-1	96	0.030	0.198	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
15	PDB:7cunA	0.079	0.075	5.214E-1	730	0.040	0.034	7cunA.pdb.gz	Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.
16	PDB:7o4iW	0.051	0.089	6.133E-1	312	0.070	0.141	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
17	PDB:4r8pL	0.052	0.105	9.452E-1	254	0.027	0.067	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
18	PDB:5gm6a	0.032	0.110	9.977E-1	123	0.030	0.154	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
19	PDB:6gejS	0.046	0.106	9.977E-1	208	0.046	0.139	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
20	PDB:7ad8D	0.050	0.084	1.173	280	0.056	0.125	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A6NHJ4	575	632	0.498	0.495	ZN860_HUMAN Zinc finger protein 860 OS=Homo sapiens OX=9606 GN=ZNF860 PE=1 SV=3
2	A6NNF4	563	616	0.473	0.482	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
3	F8WEZ9	591	492	0.484	0.618	F8WEZ9_HUMAN Zinc finger protein 480 OS=Homo sapiens OX=9606 GN=ZNF480 PE=1 SV=1
4	O75290	533	641	0.447	0.438	Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens OX=9606 GN=ZNF780A PE=1 SV=3
5	O75437	551	659	0.478	0.455	ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens OX=9606 GN=ZNF254 PE=2 SV=3
6	P17014	536	697	0.498	0.449	ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens OX=9606 GN=ZNF12 PE=1 SV=3
7	P17038	544	809	0.478	0.371	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
8	P35789	586	620	0.486	0.492	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
9	P51522	591	516	0.475	0.578	ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens OX=9606 GN=ZNF83 PE=2 SV=3
10	P51523	566	738	0.497	0.423	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
11	P52742	587	658	0.500	0.477	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
12	Q03923	559	595	0.487	0.514	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
13	Q5MCW4	572	686	0.486	0.445	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
14	Q6ECI4	563	717	0.492	0.431	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
15	Q6ZNG1	541	722	0.459	0.399	ZN600_HUMAN Zinc finger protein 600 OS=Homo sapiens OX=9606 GN=ZNF600 PE=1 SV=2
16	Q76KX8	810	674	0.648	0.604	ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens OX=9606 GN=ZNF534 PE=1 SV=1
17	Q7TMN8	527	578	0.427	0.464	Q7TMN8_MOUSE Zfp420 protein OS=Mus musculus OX=10090 GN=Zfp420 PE=1 SV=1
18	Q7Z3V5	541	609	0.471	0.486	ZN571_HUMAN Zinc finger protein 571 OS=Homo sapiens OX=9606 GN=ZNF571 PE=2 SV=3
19	Q8BLA2	526	578	0.412	0.448	Q8BLA2_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Zfp420 PE=2 SV=1
20	Q8IYB9	574	648	0.489	0.474	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01722 BolA	7.9e+02	11.8	BolA-like protein
2	PF00130 C1_1	0.00025	32.2	Phorbol esters/diacylglycerol binding domain (C1 domain)
3	PF18730 HEPN_Cthe2314	5.7e+02	11.9	Cthe_2314-like HEPN
4	PF01155 HypA	1.4	20.3	Hydrogenase/urease nickel incorporation, metallochaperone, hypA
5	PF01352 KRAB	4.8e-22	88.6	KRAB box
6	PF10484 MRP-S23	0.024	26.3	Mitochondrial ribosomal protein S23
7	PF01286 XPA_N	5.3e+02	12.1	XPA protein N-terminal
8	PF00096 zf-C2H2	7.1e-77	261.0	Zinc finger, C2H2 type
9	PF16622 zf-C2H2_11	0.47	21.6	zinc-finger C2H2-type
10	PF13894 zf-C2H2_4	1.8e-42	151.3	C2H2-type zinc finger
11	PF13912 zf-C2H2_6	1.3e-15	68.2	C2H2-type zinc finger
12	PF12171 zf-C2H2_jaz	0.0071	27.8	Zinc-finger double-stranded RNA-binding
13	PF16278 zf-C2HE	3.5	19.5	C2HE / C2H2 / C2HC zinc-binding finger
14	PF13465 zf-H2C2_2	8.3e-102	340.8	Zinc-finger double domain
15	PF18439 zf_UBZ	0.00032	31.6	Ubiquitin-Binding Zinc Finger
16	PF17032 zinc_ribbon_15	0.00013	33.9	zinc-ribbon family
17	PF09723 Zn-ribbon_8	7.4e-15	66.1	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008958022.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008958403.1	0.509	Belongs to the histone H2B family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003676	0.421	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0019222	0.993	regulation of metabolic process
GO:0051171	0.983	regulation of nitrogen compound metabolic process
GO:0080090	0.982	regulation of primary metabolic process
GO:0009889	0.980	regulation of biosynthetic process
GO:0060255	0.976	regulation of macromolecule metabolic process
GO:0031323	0.975	regulation of cellular metabolic process
GO:0051252	0.955	regulation of RNA metabolic process
GO:0010556	0.944	regulation of macromolecule biosynthetic process
GO:0031326	0.943	regulation of cellular biosynthetic process
GO:0010468	0.931	regulation of gene expression
GO:0006355	0.911	regulation of DNA-templated transcription
GO:0048519	0.772	negative regulation of biological process
GO:0009892	0.704	negative regulation of metabolic process
GO:0048523	0.690	negative regulation of cellular process
GO:0010605	0.650	negative regulation of macromolecule metabolic process
GO:0009987	0.597	cellular process
GO:0071704	0.454	organic substance metabolic process
GO:0032501	0.361	multicellular organismal process
GO:0045892	0.346	negative regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.985	nuclear lumen
GO:0005654	0.979	nucleoplasm
GO:0005737	0.930	cytoplasm
GO:0005829	0.808	cytosol
GO:0043232	0.686	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]