StarFunc result for job id Q3MJ13

User Input

>input (1102 residues)
MRTSLQAVALWGQKAPPHSITAIMITDDQRTIVTGSQEGQLCLWNLSHELKISAKELLFG
HSASVTCLARARDFSKQPYIVSAAENGEMCVWNVTNGQCMEKATLPYRHTAICYYHCSFR
MTGEGWLLCCGEYQDVLIIDAKTLAVVHSFRSSQFPDWINCMCIVHSMRIQEDSLLVVSV
AGELKVWDLSSSINSIQEKQDVYEKESKFLESLNCQTIRFCTYTERLLLVVFSKCWKVYD
YCDFSLLLTEVSRNGQFFAGGEVIAAHRILIWTEDGHSYIYQLLNSGLSKSIYPADGRVL
KETIYPHLLCSTSVQENKEQSRPFVMGYMNERKEPFYKVLFSGEVSGRITLWHIPDVPVS
KFDGSPREIPVTATWTLQDNFDKHDTMSQSIIDYFSGLKDGAGTAVVTSSEYIPSLDKLI
CGCEDGTIIITQALNAAKARLLEGGSLVKDSPPHKVLKGHHQSVTSLLYPHGLSSKLDQS
WMLSGDLDSCVILWDIFTEEILHKFFLEAGPVTSLLMSPEKFKLRGEQIICCVCGDHSVA
LLHLEGKSCLLHARKHLFPVRMIKWHPVENFLIVGCADDSVYIWEIETGTLERHETGERA
RIILNCCDDSQLVKSVLPIASETLKHKSIEQRSSSPYQLGPLPCPGLQVESSCKVTDAKF
CPRPFNVLPVKTKWSNVGFHILLFDLENLVELLLPTPLSDVDSSSSFYGGEVLRRAKSTV
EKKTLTLRKSKTACGPLSAEALAKPITESLAQGDNTIKFSEENDGIKRQKKMKISKKMQP
KPSRKVDASLTIDTAKLFLSCLLPWGVDKDLDYLCIKHLNILKLQGPISLGISLNEDNFS
LMLPGWDLCNSGMIKDYSGVNLFSRKVLDLSDKYTATLPNQVGIPRGLENNCDSLRESDT
IVYLLSRLFLVNKLVNMPLELACRVGSSFRMESIHNKMRGAGNDILNMSSFYSCLRNGKN
ESHVPEADLSLLKLISCWRDQSVQVTEAIQAVLLAEVQQHMKSLGKIPVNSQPVSMAENG
NCEMKQMLPKLEWTEELELQCVRNTLPLQTPVSPVKHDSNSNSANFQDVEDMPDRCALEE
SESPGEPRHHSWIAKVCPCKVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3YYM4	0.858	0.850	0.000	1114	0.789	0.781	D3YYM4.pdb.gz	WDR72_MOUSE WD repeat-containing protein 72 OS=Mus musculus OX=10090 GN=Wdr72 PE=1 SV=1
2	AFDB:Q3MJ13	1.000	1.000	0.000	1102	1.000	1.000	Q3MJ13.pdb.gz	WDR72_HUMAN WD repeat-containing protein 72 OS=Homo sapiens OX=9606 GN=WDR72 PE=2 SV=2
3	AFDB:Q920I9	0.626	0.469	1.847E-76	1489	0.314	0.232	Q920I9.pdb.gz	WDR7_MOUSE WD repeat-containing protein 7 OS=Mus musculus OX=10090 GN=Wdr7 PE=1 SV=3
4	AFDB:Q9W543	0.624	0.460	1.263E-68	1525	0.275	0.199	Q9W543.pdb.gz	Q9W543_DROME Rabconnectin-3B, isoform A OS=Drosophila melanogaster OX=7227 GN=Rbcn-3B PE=1 SV=1
5	AFDB:F1LRR4	0.197	0.144	5.972E-22	1551	0.118	0.084	F1LRR4.pdb.gz	F1LRR4_RAT WD repeat domain 62 OS=Rattus norvegicus OX=10116 GN=Wdr62 PE=1 SV=4
6	PDB:7d4iBE	0.208	0.254	1.244E-19	890	0.083	0.102	7d4iBE.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
7	AFDB:O60336	0.197	0.146	1.842E-18	1514	0.141	0.102	O60336.pdb.gz	MABP1_HUMAN Mitogen-activated protein kinase-binding protein 1 OS=Homo sapiens OX=9606 GN=MAPKBP1 PE=1 SV=4
8	PDB:7mq8LT	0.205	0.257	2.230E-18	869	0.105	0.133	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
9	PDB:7ajuUL	0.269	0.349	2.976E-18	779	0.081	0.114	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
10	PDB:7mq8LR	0.198	0.277	4.373E-18	773	0.073	0.103	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
11	PDB:7d5sBE	0.212	0.266	2.139E-17	865	0.101	0.128	7d5sBE.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
12	PDB:5wyjBE	0.206	0.295	9.058E-17	753	0.075	0.110	5wyjBE.pdb.gz	Molecular architecture of the 90S small subunit pre-ribosome.
13	PDB:7d5sB2	0.287	0.348	1.209E-16	851	0.114	0.148	7d5sB2.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
14	PDB:6lqsBE	0.193	0.249	1.613E-16	823	0.078	0.104	6lqsBE.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
15	AFDB:Q96KV7	0.190	0.133	6.519E-16	1748	0.093	0.058	Q96KV7.pdb.gz	WDR90_HUMAN WD repeat-containing protein 90 OS=Homo sapiens OX=9606 GN=WDR90 PE=1 SV=2
16	PDB:7mqaLQ	0.257	0.315	1.340E-15	830	0.074	0.099	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:7ajtUM	0.235	0.331	1.969E-15	762	0.064	0.092	7ajtUM.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
18	AFDB:Q960J6	0.115	0.109	7.631E-14	1183	0.123	0.115	Q960J6.pdb.gz	Q960J6_DROME LD47622p OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=2 SV=1
19	AFDB:Q9VYK6	0.230	0.178	1.570E-13	1470	0.122	0.091	Q9VYK6.pdb.gz	Q9VYK6_DROME Tomosyn, isoform C OS=Drosophila melanogaster OX=7227 GN=Tomosyn PE=1 SV=3
20	AFDB:Q09731	0.245	0.276	4.110E-13	962	0.105	0.121	Q09731.pdb.gz	BU107_SCHPO UBP9-binding protein bun107 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bun107 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3YYM4	0.0	1797	1114	0.791	0.783	WDR72_MOUSE WD repeat-containing protein 72 OS=Mus musculus OX=10090 GN=Wdr72 PE=1 SV=1
2	Q3MJ13	0.0	2281	1102	1.000	1.000	WDR72_HUMAN WD repeat-containing protein 72 OS=Homo sapiens OX=9606 GN=WDR72 PE=2 SV=2
3	Q920I9	0.0	588	1489	0.308	0.228	WDR7_MOUSE WD repeat-containing protein 7 OS=Mus musculus OX=10090 GN=Wdr7 PE=1 SV=3
4	Q9ERH3	0.0	580	1488	0.291	0.216	WDR7_RAT WD repeat-containing protein 7 OS=Rattus norvegicus OX=10116 GN=Wdr7 PE=1 SV=1
5	Q2XXU2	3.88e-126	422	1505	0.249	0.182	Q2XXU2_DROME CG17766 (Fragment) OS=Drosophila melanogaster OX=7227 GN=Rbcn-3B PE=4 SV=1
6	Q9W543	5.90e-126	422	1525	0.249	0.180	Q9W543_DROME Rabconnectin-3B, isoform A OS=Drosophila melanogaster OX=7227 GN=Rbcn-3B PE=1 SV=1
7	O46092	3.20e-110	377	1471	0.229	0.171	O46092_DROME EG:86E4.3 protein OS=Drosophila melanogaster OX=7227 GN=Rbcn-3B PE=4 SV=1
8	A2RRE0	4.38e-14	79.3	815	0.030	0.040	A2RRE0_HUMAN WDR7 protein OS=Homo sapiens OX=9606 GN=WDR7 PE=1 SV=1
9	F4HTH8	3.23e-10	67.0	1181	0.037	0.035	KTN82_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.2 OS=Arabidopsis thaliana OX=3702 GN=KTN80.2 PE=1 SV=1
10	A0A1P8AW69	7.49e-09	62.4	1019	0.034	0.037	KTN81_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.1 OS=Arabidopsis thaliana OX=3702 GN=KTN80.1 PE=1 SV=1
11	Q7ZUV2	8.88e-07	55.5	694	0.043	0.068	KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio OX=7955 GN=katnb1 PE=2 SV=1
12	A0A0G2JX20	1.33e-06	55.1	659	0.031	0.052	A0A0G2JX20_RAT Katanin p80 WD40 repeat-containing subunit B1 OS=Rattus norvegicus OX=10116 GN=Katnb1 PE=3 SV=2
13	Q8BG40	1.34e-06	55.1	658	0.031	0.052	KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus OX=10090 GN=Katnb1 PE=1 SV=1
14	B1WBN6	1.40e-06	54.7	640	0.031	0.053	B1WBN6_RAT Katnb1 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Katnb1 PE=2 SV=1
15	Q4VFZ4	1.42e-06	54.7	655	0.031	0.052	Q4VFZ4_RAT Katanin p80 WD40 repeat-containing subunit B1 OS=Rattus norvegicus OX=10116 GN=Katnb1 PE=2 SV=1
16	Q9BVA0	1.52e-06	54.7	655	0.031	0.052	KTNB1_HUMAN Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens OX=9606 GN=KATNB1 PE=1 SV=1
17	F4KB17	2.27e-05	51.2	839	0.048	0.063	KTN83_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.3 OS=Arabidopsis thaliana OX=3702 GN=KTN80.3 PE=1 SV=1
18	Q55DM1	2.56e-05	51.2	3619	0.044	0.013	LVSA_DICDI BEACH domain-containing protein lvsA OS=Dictyostelium discoideum OX=44689 GN=lvsA PE=4 SV=2
19	Q9D994	2.83e-05	49.7	303	0.034	0.125	WDR38_MOUSE WD repeat-containing protein 38 OS=Mus musculus OX=10090 GN=Wdr38 PE=2 SV=1
20	O75529	3.32e-05	50.4	589	0.038	0.071	TAF5L_HUMAN TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens OX=9606 GN=TAF5L PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	0.0011	30.5	Anaphase-promoting complex subunit 4 WD40 domain
2	PF11768 Frtz	0.96	19.4	WD repeat-containing and planar cell polarity effector protein Fritz
3	PF07569 Hira	4.9e+02	11.7	TUP1-like enhancer of split
4	PF11715 Nup160	1.4	19.3	Nucleoporin Nup120/160
5	PF00400 WD40	5.9e-09	47.6	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379619

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000260228	0.900	Matrix metalloproteinase-20
2	9606.ENSP00000373565	0.886	Protein FAM83H
3	9606.ENSP00000406925	0.806	Odontogenesis associated phosphoprotein
4	9606.ENSP00000389870	0.798	Homeobox protein DLX-3
5	9606.ENSP00000379383	0.775	Enamelin
6	9606.ENSP00000326159	0.770	Kallikrein-4
7	9606.ENSP00000370088	0.741	Amelogenin, X isoform
8	9606.ENSP00000375778	0.740	Laminin subunit beta-3
9	9606.ENSP00000443598	0.736	Protein FAM214A
10	9606.ENSP00000257663	0.734	Transmembrane protein 60
11	9606.ENSP00000350954	0.725	WD repeat-containing protein 37
12	9606.ENSP00000431840	0.725	Sodium/potassium/calcium exchanger 4
13	9606.ENSP00000313809	0.686	Ameloblastin
14	9606.ENSP00000468308	0.679	Pseudokinase FAM20A
15	9606.ENSP00000341013	0.677	Amelotin
16	9606.ENSP00000270593	0.634	Testicular acid phosphatase
17	9606.ENSP00000337816	0.633	Matrix metalloproteinase-25
18	9606.ENSP00000351596	0.605	Tetratricopeptide repeat protein 37
19	9606.ENSP00000341815	0.600	Transcription factor SOX-18
20	9606.ENSP00000301873	0.573	Latent-transforming growth factor beta-binding protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0009653	0.964	anatomical structure morphogenesis
GO:0051179	0.792	localization
GO:0065007	0.689	biological regulation
GO:0048513	0.634	animal organ development
GO:0071840	0.633	cellular component organization or biogenesis
GO:0016043	0.558	cellular component organization
GO:0042476	0.553	odontogenesis
GO:0050789	0.457	regulation of biological process
GO:0048646	0.438	anatomical structure formation involved in morphogenesis
GO:0051641	0.422	cellular localization
GO:0050794	0.375	regulation of cellular process
GO:0033036	0.355	macromolecule localization
GO:0042475	0.335	odontogenesis of dentin-containing tooth
GO:0022411	0.310	cellular component disassembly
GO:0009888	0.300	tissue development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0012505	0.995	endomembrane system
GO:0043227	0.995	membrane-bounded organelle
GO:0043231	0.988	intracellular membrane-bounded organelle
GO:0031982	0.898	vesicle
GO:0005634	0.862	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]