StarFunc result for job id Q3SX64

User Input

>input (289 residues)
MGTLSCDSTPRLATAPLGRRVTEGQIPETGLRKSCGTATLENGSGPGLYVLPSTVGFINH
DCTRVASPAYSLVRRPSEAPPQDTSPGPIYFLDPKVTRFGRSCTPAYSMQGRAKSRGPEV
TPGPGAYSPEKVPPVRHRTPPAFTLGCRLPLKPLDTSAPAPNAYTMPPLWGSQIFTKPSS
PSYTVVGRTPPARPPQDPAEIPGPGQYDSPDANTYRQRLPAFTMLGRPRAPRPLEETPGP
GAHCPEQVTVNKARAPAFSMGIRHSKRASTMAATTPSRPAGHRLPGRCC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3SX64	1.000	1.000	2.097E-47	289	1.000	1.000	Q3SX64.pdb.gz	CMA1D_HUMAN Protein CIMAP1D OS=Homo sapiens OX=9606 GN=CIMAP1D PE=1 SV=2
2	PDB:6bjrA	0.062	0.041	2.270	575	0.048	0.024	6bjrA.pdb.gz	Structure of prothrombin in the closed form reveals new details on the mechanism of activation.
3	PDB:3jb9A	0.061	0.017	6.128	1964	0.048	0.007	3jb9A.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3SX64	0.0	574	289	1.000	1.000	CMA1D_HUMAN Protein CIMAP1D OS=Homo sapiens OX=9606 GN=CIMAP1D PE=1 SV=2
2	B3DI43	4.37e-64	203	252	0.388	0.444	B3DI43_DANRE Outer dense fiber of sperm tails 3-like 2b OS=Danio rerio OX=7955 GN=cimap1d PE=2 SV=1
3	Q8IXM7	1.16e-40	144	274	0.311	0.328	CMA1C_HUMAN Protein CIMAP1C OS=Homo sapiens OX=9606 GN=CIMAP1C PE=1 SV=1
4	Q96PU9	2.40e-35	129	254	0.277	0.315	CMA1A_HUMAN Ciliary microtubule associated protein 1A OS=Homo sapiens OX=9606 GN=CIMAP1A PE=1 SV=1
5	Q920N1	2.90e-35	129	254	0.273	0.311	CMA1A_MOUSE Ciliary microtubule associated protein 1A OS=Mus musculus OX=10090 GN=Cimap1a PE=1 SV=2
6	A8MYP8	1.44e-25	103	253	0.270	0.308	CMA1B_HUMAN Ciliary microtubule associated protein 1B OS=Homo sapiens OX=9606 GN=CIMAP1B PE=1 SV=1
7	M9PCD3	3.17e-21	92.4	261	0.273	0.303	M9PCD3_DROME Uncharacterized protein, isoform K OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8086 PE=4 SV=1
8	Q9VLQ4	3.42e-18	84.3	272	0.270	0.287	Q9VLQ4_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8086 PE=4 SV=2
9	Q8IPG0	5.58e-18	84.3	298	0.270	0.262	Q8IPG0_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=CG8113 PE=4 SV=1
10	M9PCJ4	1.47e-17	85.1	1512	0.239	0.046	M9PCJ4_DROME Uncharacterized protein, isoform M OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8086 PE=4 SV=1
11	M9PCX6	1.49e-17	85.1	1448	0.239	0.048	M9PCX6_DROME Uncharacterized protein, isoform N OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8086 PE=4 SV=1
12	M9PF71	1.50e-17	85.1	1516	0.239	0.046	M9PF71_DROME Uncharacterized protein, isoform O OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8086 PE=4 SV=1
13	M9PB72	1.54e-17	85.1	1501	0.239	0.046	M9PB72_DROME Uncharacterized protein, isoform P OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8086 PE=4 SV=1
14	M9NEC3	1.60e-17	85.1	1568	0.239	0.044	M9NEC3_DROME Uncharacterized protein, isoform H OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8086 PE=4 SV=1
15	M9NCS7	1.61e-17	85.1	1569	0.239	0.044	M9NCS7_DROME Uncharacterized protein, isoform G OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8086 PE=4 SV=1
16	Q7KTI5	1.64e-17	85.1	1534	0.239	0.045	Q7KTI5_DROME Uncharacterized protein, isoform L OS=Drosophila melanogaster OX=7227 GN=CG8113 PE=4 SV=3
17	Q7KTI6	1.64e-17	85.1	1453	0.239	0.047	Q7KTI6_DROME Uncharacterized protein, isoform J OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8086 PE=4 SV=3
18	M9PB71	1.70e-17	84.7	1603	0.239	0.043	M9PB71_DROME Uncharacterized protein, isoform I OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8086 PE=4 SV=1
19	Q57XU0	4.64e-11	65.9	2395	0.197	0.024	Q57XU0_TRYB2 Sperm-tail PG-rich repeat OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.21H15.130 PE=4 SV=1
20	Q961P7	7.06e-08	55.5	426	0.204	0.138	Q961P7_DROME GH11964p OS=Drosophila melanogaster OX=7227 GN=CG8113 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07004 SHIPPO-rpt	5.3e-13	60.4	Sperm-tail PG-rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000318029

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000275493	0.720	Epidermal growth factor receptor
2	9606.ENSP00000010299	0.635	X-linked retinitis pigmentosa GTPase regulator-interacting protein 1
3	9606.ENSP00000351569	0.611	Small integral membrane protein 7
4	9606.ENSP00000352265	0.600	Tubulin polyglutamylase complex subunit 1
5	9606.ENSP00000300976	0.597	Kelch-like protein 26
6	9606.ENSP00000258821	0.596	Tetratricopeptide repeat protein 5
7	9606.ENSP00000328677	0.567	C2 calcium-dependent domain-containing protein 4C
8	9606.ENSP00000322609	0.561	Glutamate-rich protein 3
9	9606.ENSP00000355385	0.556	R3H domain containing 4
10	9606.ENSP00000359768	0.556	E3 SUMO-protein ligase KIAA1586
11	9606.ENSP00000386229	0.556	Regulator of G-protein signaling 14
12	9606.ENSP00000475473	0.545	Protein Churchill
13	9606.ENSP00000269878	0.524	Calcium and integrin binding family member 3
14	9606.ENSP00000340088	0.524	Testicular haploid expressed gene protein
15	9606.ENSP00000386138	0.510	Olfactory receptor 1C1
16	9606.ENSP00000246166	0.504	Protein farnesyltransferase subunit beta
17	9606.ENSP00000483239	0.504	Olfactory receptor 4M2
18	9606.ENSP00000386557	0.503	Uncharacterized membrane protein C19orf24
19	9606.ENSP00000329467	0.501	Uncharacterized protein
20	9606.ENSP00000361095	0.501	Transmembrane protein 69

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.968	cellular process
GO:0032501	0.684	multicellular organismal process
GO:0071704	0.622	organic substance metabolic process
GO:0043170	0.529	macromolecule metabolic process
GO:0006807	0.496	nitrogen compound metabolic process
GO:0065007	0.485	biological regulation
GO:0050794	0.435	regulation of cellular process
GO:0003008	0.391	system process
GO:0044238	0.371	primary metabolic process
GO:0050877	0.322	nervous system process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0099513	0.997	polymeric cytoskeletal fiber
GO:0015630	0.996	microtubule cytoskeleton
GO:0005881	0.992	cytoplasmic microtubule
GO:0043231	0.877	intracellular membrane-bounded organelle
GO:0005634	0.670	nucleus
GO:0071944	0.398	cell periphery
GO:0032991	0.383	protein-containing complex
GO:0016020	0.345	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]