StarFunc result for job id Q3SXY7

User Input

>input (679 residues)
MHLFACLCIVLSFLEGVGCLCPSQCTCDYHGRNDGSGSRLVLCNDMDMNELPTNLPVDTV
KLRIEKTVIRRISAEAFYYLVELQYLWVTYNSVASIDPSSFYNLKQLHELRLDGNSLAAF
PWASLLDMPLLRTLDLHNNKITSVPNEALRYLKNLAYLDLSSNRLTTLPPDFLESWTHLV
STPSGVLDLSPSRIILGLQDNPWFCDCHISKMIELSKVVDPAIVLLDPLMTCSEPERLTG
ILFQRAELEHCLKPSVMTSATKIMSALGSNVLLRCDATGFPTPQITWTRSDSSPVNYTVI
QESPEEGVRWSIMSLTGISSKDAGDYKCKAKNLAGMSEAVVTVTVLGITTTPIPPDTSER
TGDHPEWDVQPGSGRSTSVSSASSYLWSSSFSPTSSFSASTLSPPSTASFSLSPFSSSTV
SSTTTLSTSISASTTMANKRSFQLHQGGKRNLKVAKNGSKLPPASTSKKEELALLDQTML
TETNAAIENLRVVSETKESVTLTWNMINTTHNSAVTVLYSKYGGKDLLLLNADSSKNQVT
IDGLEPGGQYMACVCPKGVPPQKDQCITFSTERVEGDDSQWSLLLVVTSTACVVILPLIC
FLLYKVCKLQCKSEPFWEDDLAKETYIQFETLFPRSQSVGELWTRSHRDDSEKLLLCSRS
SVESQVTFKSEGSRPEYYC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3SXY7	1.000	1.000	0.000	679	1.000	1.000	Q3SXY7.pdb.gz	LRIT3_HUMAN Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 3 OS=Homo sapiens OX=9606 GN=LRIT3 PE=1 SV=3
2	AFDB:W8DXL4	0.443	0.441	5.171E-98	681	0.725	0.722	W8DXL4.pdb.gz	LRIT3_MOUSE Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 3 OS=Mus musculus OX=10090 GN=Lrit3 PE=1 SV=1
3	AFDB:Q9JMH2	0.355	0.385	5.217E-61	623	0.328	0.358	Q9JMH2.pdb.gz	LRIT1_RAT Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Lrit1 PE=1 SV=2
4	AFDB:F1QNH9	0.338	0.324	8.190E-30	712	0.211	0.201	F1QNH9.pdb.gz
5	AFDB:O75094	0.288	0.131	5.869E-14	1523	0.094	0.042	O75094.pdb.gz	SLIT3_HUMAN Slit homolog 3 protein OS=Homo sapiens OX=9606 GN=SLIT3 PE=2 SV=3
6	AFDB:O94813	0.281	0.128	1.621E-13	1529	0.087	0.039	O94813.pdb.gz	SLIT2_HUMAN Slit homolog 2 protein OS=Homo sapiens OX=9606 GN=SLIT2 PE=1 SV=1
7	AFDB:F1RCV3	0.280	0.128	3.375E-13	1516	0.091	0.041	F1RCV3.pdb.gz	F1RCV3_DANRE Slit homolog 3 (Drosophila) OS=Danio rerio OX=7955 GN=zgc:111911 PE=1 SV=1
8	AFDB:A1Z920	0.124	0.058	1.249E-11	1526	0.084	0.037	A1Z920.pdb.gz	A1Z920_DROME FI24025p1 OS=Drosophila melanogaster OX=7227 GN=fra PE=1 SV=1
9	PDB:5y31B	0.227	0.294	5.175E-11	511	0.090	0.119	5y31B.pdb.gz	Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22.
10	AFDB:P35858	0.247	0.276	9.002E-11	605	0.071	0.079	P35858.pdb.gz	ALS_HUMAN Insulin-like growth factor-binding protein complex acid labile subunit OS=Homo sapiens OX=9606 GN=IGFALS PE=1 SV=1
11	AFDB:X2JCW3	0.144	0.182	1.983E-10	534	0.062	0.079	X2JCW3.pdb.gz	X2JCW3_DROME Dpr-interacting protein beta, isoform G OS=Drosophila melanogaster OX=7227 GN=DIP-beta PE=4 SV=1
12	PDB:1xcdA	0.219	0.472	4.514E-8	305	0.071	0.157	1xcdA.pdb.gz
13	PDB:1m9sA	0.195	0.250	2.747E-7	523	0.074	0.096	1m9sA.pdb.gz
14	PDB:1e07A	0.122	0.129	1.126E-6	642	0.050	0.053	1e07A.pdb.gz
15	PDB:2ft3F	0.203	0.429	4.882E-6	305	0.066	0.148	2ft3F.pdb.gz
16	PDB:6pxvA	0.120	0.104	8.112E-6	823	0.084	0.069	6pxvA.pdb.gz
17	PDB:7xw5R	0.155	0.179	1.017E-5	572	0.068	0.080	7xw5R.pdb.gz	Hormone- and antibody-mediated activation of the thyrotropin receptor.
18	PDB:7wrqA	0.157	0.182	1.204E-5	566	0.075	0.090	7wrqA.pdb.gz
19	PDB:6dldD	0.109	0.258	1.426E-5	269	0.040	0.100	6dldD.pdb.gz
20	PDB:5yq5B	0.189	0.354	1.509E-5	306	0.072	0.160	5yq5B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3SXY7	0.0	1392	679	1.000	1.000	LRIT3_HUMAN Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 3 OS=Homo sapiens OX=9606 GN=LRIT3 PE=1 SV=3
2	W8DXL4	0.0	943	681	0.717	0.715	LRIT3_MOUSE Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 3 OS=Mus musculus OX=10090 GN=Lrit3 PE=1 SV=1
3	Q9JMH2	2.90e-86	285	623	0.215	0.234	LRIT1_RAT Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Lrit1 PE=1 SV=2
4	Q6PJG9	3.81e-28	122	635	0.144	0.154	LRFN4_HUMAN Leucine-rich repeat and fibronectin type-III domain-containing protein 4 OS=Homo sapiens OX=9606 GN=LRFN4 PE=1 SV=1
5	Q96NI6	1.19e-26	118	719	0.152	0.143	LRFN5_HUMAN Leucine-rich repeat and fibronectin type-III domain-containing protein 5 OS=Homo sapiens OX=9606 GN=LRFN5 PE=1 SV=2
6	D4ABX8	1.54e-26	117	636	0.158	0.168	LRFN4_RAT Leucine-rich repeat and fibronectin type-III domain-containing protein 4 OS=Rattus norvegicus OX=10116 GN=Lrfn4 PE=1 SV=1
7	Q80XU8	1.88e-26	117	636	0.158	0.168	LRFN4_MOUSE Leucine-rich repeat and fibronectin type-III domain-containing protein 4 OS=Mus musculus OX=10090 GN=Lrfn4 PE=1 SV=1
8	Q8BXA0	2.00e-26	117	719	0.152	0.143	LRFN5_MOUSE Leucine-rich repeat and fibronectin type-III domain-containing protein 5 OS=Mus musculus OX=10090 GN=Lrfn5 PE=1 SV=1
9	D4A1J9	5.11e-26	115	719	0.150	0.142	LRFN5_RAT Leucine-rich repeat and fibronectin type-III domain-containing protein 5 OS=Rattus norvegicus OX=10116 GN=Lrfn5 PE=1 SV=1
10	Q6UXK2	8.49e-26	115	745	0.118	0.107	ISLR2_HUMAN Immunoglobulin superfamily containing leucine-rich repeat protein 2 OS=Homo sapiens OX=9606 GN=ISLR2 PE=1 SV=1
11	Q5RKR3	1.64e-25	114	745	0.121	0.110	ISLR2_MOUSE Immunoglobulin superfamily containing leucine-rich repeat protein 2 OS=Mus musculus OX=10090 GN=Islr2 PE=1 SV=1
12	Q8BLY3	1.16e-23	108	626	0.158	0.171	LRFN3_MOUSE Leucine-rich repeat and fibronectin type-III domain-containing protein 3 OS=Mus musculus OX=10090 GN=Lrfn3 PE=1 SV=1
13	B0BNK7	1.75e-23	107	626	0.158	0.171	LRFN3_RAT Leucine-rich repeat and fibronectin type-III domain-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Lrfn3 PE=1 SV=1
14	Q9BTN0	9.19e-23	105	628	0.158	0.170	LRFN3_HUMAN Leucine-rich repeat and fibronectin type-III domain-containing protein 3 OS=Homo sapiens OX=9606 GN=LRFN3 PE=2 SV=1
15	Q9P244	1.46e-21	102	771	0.141	0.125	LRFN1_HUMAN Leucine-rich repeat and fibronectin type III domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LRFN1 PE=1 SV=2
16	Q2WF71	2.67e-21	101	766	0.141	0.125	LRFN1_MOUSE Leucine-rich repeat and fibronectin type III domain-containing protein 1 OS=Mus musculus OX=10090 GN=Lrfn1 PE=1 SV=1
17	P0C7J6	2.72e-21	101	766	0.141	0.125	LRFN1_RAT Leucine-rich repeat and fibronectin type III domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Lrfn1 PE=1 SV=1
18	Q9VZZ4	2.00e-20	99.0	1527	0.141	0.063	PXDN_DROME Peroxidasin OS=Drosophila melanogaster OX=7227 GN=Pxn PE=1 SV=1
19	P91643	3.34e-20	97.8	880	0.137	0.106	P91643_DROME KEK1 OS=Drosophila melanogaster OX=7227 GN=kek1 PE=1 SV=1
20	Q9VK54	3.68e-20	97.8	880	0.137	0.106	Q9VK54_DROME Kekkon 1, isoform B OS=Drosophila melanogaster OX=7227 GN=kek1 PE=4 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08205 C2-set_2	4.7e+02	12.2	CD80-like C2-set immunoglobulin domain
2	PF20088 DUF6480	4.2e+02	12.3	Family of unknown function (DUF6480)
3	PF00041 fn3	0.087	24.5	Fibronectin type III domain
4	PF07679 I-set	2.1e-08	45.4	Immunoglobulin I-set domain
5	PF00047 ig	0.92	21.1	Immunoglobulin domain
6	PF13895 Ig_2	5.1e-06	38.0	Immunoglobulin domain
7	PF13927 Ig_3	8.2e-11	53.6	Immunoglobulin domain
8	PF00560 LRR_1	0.0071	27.5	Leucine Rich Repeat
9	PF12799 LRR_4	6.8e-11	53.4	Leucine Rich repeats (2 copies)
10	PF13306 LRR_5	0.014	26.7	BspA type Leucine rich repeat region (6 copies)
11	PF13516 LRR_6	4.6e+02	12.4	Leucine Rich repeat
12	PF13855 LRR_8	3.1e-18	76.6	Leucine rich repeat
13	PF07686 V-set	1.5	20.4	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000469759

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000483469	0.847	Probable G-protein coupled receptor 179
2	9606.ENSP00000437849	0.788	Transient receptor potential cation channel subfamily M member 1
3	9606.ENSP00000414378	0.728	Ephrin-A4
4	9606.ENSP00000231188	0.709	Metabotropic glutamate receptor 6
5	9606.ENSP00000417610	0.707	Ras-related protein Rab-23
6	9606.ENSP00000365441	0.702	Voltage-dependent L-type calcium channel subunit alpha-1F
7	9606.ENSP00000324960	0.697	Calcium-binding protein 4
8	9606.ENSP00000261892	0.625	Sodium/potassium/calcium exchanger 1
9	9606.ENSP00000412940	0.615	FRAS1-related extracellular matrix protein 1
10	9606.ENSP00000232461	0.614	Guanine nucleotide-binding protein G(t) subunit alpha-1
11	9606.ENSP00000261837	0.574	Guanine nucleotide-binding protein subunit beta-5
12	9606.ENSP00000380876	0.566	Regulator of G-protein signaling 11
13	9606.ENSP00000355192	0.529	Voltage-dependent L-type calcium channel subunit alpha-1S
14	9606.ENSP00000372169	0.529	Voltage-dependent calcium channel subunit alpha-2/delta-4
15	9606.ENSP00000302586	0.519	Kelch repeat and BTB domain containing 2
16	9606.ENSP00000355523	0.511	Regulator of G-protein signaling 7
17	9606.ENSP00000314992	0.510	Visual pigment-like receptor peropsin
18	9606.ENSP00000332681	0.507	LRP2-binding protein
19	9606.ENSP00000346964	0.504	Pikachurin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.987	regulation of biological process
GO:0050794	0.983	regulation of cellular process
GO:0032501	0.869	multicellular organismal process
GO:0009966	0.625	regulation of signal transduction
GO:0090287	0.609	regulation of cellular response to growth factor stimulus
GO:0009987	0.597	cellular process
GO:0040036	0.472	regulation of fibroblast growth factor receptor signaling pathway
GO:0050896	0.424	response to stimulus
GO:0007601	0.371	visual perception

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0071944	0.993	cell periphery
GO:0005886	0.981	plasma membrane
GO:0043226	0.753	organelle
GO:0005622	0.650	intracellular anatomical structure
GO:0043227	0.536	membrane-bounded organelle
GO:0005737	0.531	cytoplasm
GO:0043231	0.499	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]