StarFunc result for job id Q3SXZ3

User Input

>input (478 residues)
MELLTFKDVAIEFSPEEWKCLDTSQQNLYRDVMLENYRNLVSLGVSISNPDLVTSLEQRK
EPYNLKIHETAARPPAVCSHFTQNLWTVQGIEDSFHKLIPKGHEKRGHENLRKTCKSINE
CKVQKGGYNRINQCLLTTQKKTIQSNICVKVFHKFSNSNKDKIRYTGDKTFKCKECGKSF
HVLSRLTQHKRIHTGENPYTCEECGKAFNWSSILTKHKRIHAREKFYKCEECGKGFTRSS
HLTKHKRIHTGEKPYICEKCGKAFNQSSTLNLHKRIHSAQKYYKCEECGKAFKWSSSLNE
HKRIHAGEKPFSCEECGNVFTTSSDFAKHKRIHTGEKPYKCEECGKSFNRSTTLTTHKRI
HTGEKPYTCEECGKAFNWSSTLNVHKRIHSGKNPYKCEDCGKAFKVFANLHNHKKIHTGE
KPYICKQCGKAFKQSSHLNKHKKIHTVDKPYKCKECGKAFKQYSNLPQHKRTHTGGKF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15928	0.465	0.468	9.530E-58	474	0.682	0.688	Q15928.pdb.gz	ZN141_HUMAN Zinc finger protein 141 OS=Homo sapiens OX=9606 GN=ZNF141 PE=1 SV=1
2	AFDB:Q96JC4	0.554	0.510	1.570E-56	524	0.651	0.594	Q96JC4.pdb.gz	ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens OX=9606 GN=ZNF479 PE=1 SV=1
3	AFDB:Q03923	0.538	0.446	1.546E-55	595	0.640	0.514	Q03923.pdb.gz	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
4	AFDB:Q14593	0.515	0.441	1.415E-53	569	0.663	0.557	Q14593.pdb.gz	ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens OX=9606 GN=ZNF273 PE=1 SV=3
5	AFDB:A6NNF4	0.517	0.355	1.587E-53	738	0.630	0.408	A6NNF4.pdb.gz	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
6	AFDB:P35789	0.472	0.372	1.779E-53	620	0.642	0.495	P35789.pdb.gz	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
7	AFDB:Q8IYN0	0.613	0.556	1.047E-52	542	0.630	0.555	Q8IYN0.pdb.gz	ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens OX=9606 GN=ZNF100 PE=1 SV=2
8	AFDB:Q05481	0.402	0.198	1.563E-52	1191	0.640	0.257	Q05481.pdb.gz	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
9	AFDB:P17038	0.258	0.168	1.654E-52	809	0.663	0.392	P17038.pdb.gz	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
10	AFDB:Q8IYB9	0.519	0.399	2.431E-51	648	0.676	0.498	Q8IYB9.pdb.gz	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
11	PDB:3w5kB	0.112	0.330	2.382E-4	110	0.077	0.336	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:7ungi	0.054	0.081	6.740E-1	250	0.054	0.104	7ungi.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
13	PDB:6gejS	0.060	0.106	8.472E-1	208	0.059	0.135	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
14	PDB:7o4iW	0.063	0.089	1.194	312	0.071	0.109	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
15	PDB:5gm6a	0.040	0.115	1.501	123	0.048	0.187	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
16	PDB:4kblA	0.055	0.063	1.886	395	0.086	0.104	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
17	PDB:5n5yI	0.039	0.112	1.886	99	0.040	0.192	5n5yI.pdb.gz	Structural Basis of RNA Polymerase I Transcription Initiation.
18	PDB:2f9yB	0.050	0.071	2.239	257	0.033	0.062	2f9yB.pdb.gz	The Structure of the Carboxyltransferase Component of Acetyl-CoA Carboxylase Reveals a Zinc-Binding Motif Unique to the Bacterial Enzyme(,).
19	PDB:6hivCd	0.070	0.113	2.371	291	0.056	0.093	6hivCd.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
20	PDB:7uhyC	0.050	0.043	2.371	578	0.052	0.043	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NNF4	0.0	607	616	0.634	0.492	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
2	O75437	0.0	580	659	0.619	0.449	ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens OX=9606 GN=ZNF254 PE=2 SV=3
3	P17038	0.0	570	809	0.615	0.363	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
4	P35789	0.0	605	620	0.642	0.495	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
5	Q03923	0.0	603	595	0.638	0.513	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
6	Q03936	0.0	629	586	0.665	0.543	ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens OX=9606 GN=ZNF92 PE=1 SV=2
7	Q05481	0.0	598	1191	0.667	0.268	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
8	Q14593	0.0	598	569	0.640	0.538	ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens OX=9606 GN=ZNF273 PE=1 SV=3
9	Q15928	0.0	663	474	0.684	0.690	ZN141_HUMAN Zinc finger protein 141 OS=Homo sapiens OX=9606 GN=ZNF141 PE=1 SV=1
10	Q2NKJ9	0.0	612	569	0.634	0.533	Q2NKJ9_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=1
11	Q8IW36	0.0	534	515	0.588	0.546	ZN695_HUMAN Zinc finger protein 695 OS=Homo sapiens OX=9606 GN=ZNF695 PE=1 SV=4
12	Q8IYB9	0.0	657	648	0.724	0.534	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
13	Q8IYN0	0.0	611	542	0.642	0.566	ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens OX=9606 GN=ZNF100 PE=1 SV=2
14	Q8IYX0	0.0	541	411	0.561	0.652	ZN679_HUMAN Zinc finger protein 679 OS=Homo sapiens OX=9606 GN=ZNF679 PE=1 SV=2
15	Q8TD23	0.0	584	568	0.609	0.512	ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens OX=9606 GN=ZNF675 PE=1 SV=3
16	Q96H40	0.0	555	463	0.579	0.598	ZN486_HUMAN Zinc finger protein 486 OS=Homo sapiens OX=9606 GN=ZNF486 PE=2 SV=4
17	Q96JC4	0.0	607	524	0.628	0.573	ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens OX=9606 GN=ZNF479 PE=1 SV=1
18	Q9H8G1	0.0	607	570	0.634	0.532	ZN430_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=3
19	Q5JVG8	1.62e-178	509	444	0.536	0.577	ZN506_HUMAN Zinc finger protein 506 OS=Homo sapiens OX=9606 GN=ZNF506 PE=2 SV=2
20	Q49A12	1.67e-172	497	536	0.536	0.478	Q49A12_HUMAN ZNF85 protein OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07975 C1_4	0.28	22.8	TFIIH C1-like domain
2	PF19148 DUF5830	6.3e+02	11.7	Family of unknown function (DUF5830)
3	PF19561 DUF6083	8.8e+02	11.1	Family of unknown function (DUF6083)
4	PF19647 DUF6150	72	14.8	Family of unknown function (DUF6150)
5	PF09538 FYDLN_acid	58	15.8	Protein of unknown function (FYDLN_acid)
6	PF07754 HVO_2753_ZBP	2.5	19.3	Small zinc finger protein HVO_2753-like, Zn-binding pocket
7	PF01155 HypA	0.72	21.3	Hydrogenase/urease nickel incorporation, metallochaperone, hypA
8	PF01352 KRAB	1.2e-21	87.3	KRAB box
9	PF01096 TFIIS_C	7e+02	11.5	Transcription factor S-II (TFIIS)
10	PF01286 XPA_N	2.4e-12	58.0	XPA protein N-terminal
11	PF14149 YhfH	15	17.0	YhfH-like protein
12	PF01428 zf-AN1	73	14.9	AN1-like Zinc finger
13	PF00096 zf-C2H2	1.6e-53	187.4	Zinc finger, C2H2 type
14	PF16622 zf-C2H2_11	3.4e-06	38.0	zinc-finger C2H2-type
15	PF13894 zf-C2H2_4	2.9e-29	110.2	C2H2-type zinc finger
16	PF13912 zf-C2H2_6	3.1e-18	76.5	C2H2-type zinc finger
17	PF15909 zf-C2H2_8	0.0017	30.0	C2H2-type zinc ribbon
18	PF12171 zf-C2H2_jaz	2.8e-08	45.0	Zinc-finger double-stranded RNA-binding
19	PF13465 zf-H2C2_2	3.2e-72	247.2	Zinc-finger double domain
20	PF02591 zf-RING_7	6e-05	34.4	C4-type zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000480556

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000339405	0.517	TP53 target 3B
2	9606.ENSP00000455132	0.517	TP53 target 3C
3	9606.ENSP00000455596	0.517	TP53 target 3D
4	9606.ENSP00000485467	0.517	TP53 target 3C
5	9606.ENSP00000485635	0.517	annotation not available
6	9606.ENSP00000331643	0.508	piggyBac transposable element derived 2
7	9606.ENSP00000381672	0.507	TP53 target 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003677	0.569	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0060255	0.970	regulation of macromolecule metabolic process
GO:0050794	0.887	regulation of cellular process
GO:0031323	0.863	regulation of cellular metabolic process
GO:0051171	0.862	regulation of nitrogen compound metabolic process
GO:0080090	0.857	regulation of primary metabolic process
GO:0048519	0.781	negative regulation of biological process
GO:0009987	0.771	cellular process
GO:0019219	0.710	regulation of nucleobase-containing compound metabolic process
GO:0008152	0.630	metabolic process
GO:0009889	0.592	regulation of biosynthetic process
GO:0071704	0.556	organic substance metabolic process
GO:0044237	0.553	cellular metabolic process
GO:0044238	0.546	primary metabolic process
GO:0006807	0.532	nitrogen compound metabolic process
GO:0006355	0.440	regulation of DNA-templated transcription
GO:1901564	0.407	organonitrogen compound metabolic process
GO:0031324	0.347	negative regulation of cellular metabolic process
GO:0051172	0.342	negative regulation of nitrogen compound metabolic process
GO:0010605	0.304	negative regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031974	0.967	membrane-enclosed lumen
GO:0005737	0.956	cytoplasm
GO:0031981	0.954	nuclear lumen
GO:0005654	0.861	nucleoplasm
GO:0043232	0.617	intracellular non-membrane-bounded organelle
GO:0005730	0.309	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]