StarFunc result for job id Q3SY84

User Input

>input (523 residues)
MSRQFTCKSGAAAKGGFSGCSAVLSGGSSSSFRAGSKGLSGGFGSRSLYSLGGVRSLNVA
SGSGKSGGYGFGRGRASGFAGSMFGSVALGPVCPTVCPPGGIHQVTVNESLLAPLNVELD
PEIQKVRAQEREQIKALNNKFASFIDKVRFLEQQNQVLETKWELLQQLDLNNCKNNLEPI
LEGYISNLRKQLETLSGDRVRLDSELRNVRDVVEDYKKRYEEEINKRTAAENEFVLLKKD
VDAAYANKVELQAKVESMDQEIKFFRCLFEAEITQIQSHISDMSVILSMDNNRNLDLDSI
IDEVRTQYEEIALKSKAEAEALYQTKFQELQLAAGRHGDDLKNTKNEISELTRLIQRIRS
EIENVKKQASNLETAIADAEQRGDNALKDARAKLDELEGALHQAKEELARMLREYQELMS
LKLALDMEIATYRKLLESEECRMSGEFPSPVSISIISSTSGGSVYGFRPSMVSGGYVANS
SNCISGVCSVRGGEGRSRGSANDYKDTLGKGSSLSAPSKKTSR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86Y46	0.415	0.403	1.650E-47	540	0.834	0.807	Q86Y46.pdb.gz	K2C73_HUMAN Keratin, type II cytoskeletal 73 OS=Homo sapiens OX=9606 GN=KRT73 PE=1 SV=1
2	AFDB:Q7RTS7	0.409	0.406	2.640E-43	529	0.750	0.741	Q7RTS7.pdb.gz	K2C74_HUMAN Keratin, type II cytoskeletal 74 OS=Homo sapiens OX=9606 GN=KRT74 PE=1 SV=2
3	AFDB:Q14CN4	0.344	0.351	3.963E-40	511	0.734	0.751	Q14CN4.pdb.gz	K2C72_HUMAN Keratin, type II cytoskeletal 72 OS=Homo sapiens OX=9606 GN=KRT72 PE=1 SV=2
4	AFDB:Q9Z331	0.321	0.303	2.250E-32	562	0.585	0.544	Q9Z331.pdb.gz	K2C6B_MOUSE Keratin, type II cytoskeletal 6B OS=Mus musculus OX=10090 GN=Krt6b PE=1 SV=3
5	AFDB:Q0IIN1	0.298	0.273	1.340E-30	578	0.553	0.500	Q0IIN1.pdb.gz	Q0IIN1_HUMAN Keratin 77 OS=Homo sapiens OX=9606 GN=KRT77 PE=1 SV=1
6	AFDB:Q6IFZ6	0.331	0.306	1.635E-28	572	0.549	0.502	Q6IFZ6.pdb.gz	K2C1B_MOUSE Keratin, type II cytoskeletal 1b OS=Mus musculus OX=10090 GN=Krt77 PE=1 SV=1
7	AFDB:P35908	0.305	0.260	2.701E-28	639	0.608	0.498	P35908.pdb.gz	K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens OX=9606 GN=KRT2 PE=1 SV=2
8	AFDB:P04104	0.301	0.264	6.387E-28	637	0.537	0.441	P04104.pdb.gz	K2C1_MOUSE Keratin, type II cytoskeletal 1 OS=Mus musculus OX=10090 GN=Krt1 PE=1 SV=4
9	AFDB:Q3TTY5	0.354	0.275	8.508E-28	707	0.577	0.427	Q3TTY5.pdb.gz	K22E_MOUSE Keratin, type II cytoskeletal 2 epidermal OS=Mus musculus OX=10090 GN=Krt2 PE=1 SV=1
10	AFDB:Q9NSB4	0.297	0.302	5.028E-25	513	0.465	0.474	Q9NSB4.pdb.gz	KRT82_HUMAN Keratin, type II cuticular Hb2 OS=Homo sapiens OX=9606 GN=KRT82 PE=1 SV=3
11	PDB:5lj5O	0.104	0.166	1.996	283	0.046	0.085	5lj5O.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
12	PDB:7mqaNA	0.065	0.101	2.660	295	0.038	0.068	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:5tbyA	0.106	0.067	9.668	954	0.065	0.036	5tbyA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95678	0.0	568	551	0.560	0.532	K2C75_HUMAN Keratin, type II cytoskeletal 75 OS=Homo sapiens OX=9606 GN=KRT75 PE=1 SV=2
2	P02538	0.0	539	564	0.549	0.509	K2C6A_HUMAN Keratin, type II cytoskeletal 6A OS=Homo sapiens OX=9606 GN=KRT6A PE=1 SV=3
3	P04259	0.0	546	564	0.551	0.511	K2C6B_HUMAN Keratin, type II cytoskeletal 6B OS=Homo sapiens OX=9606 GN=KRT6B PE=1 SV=5
4	P07744	0.0	526	525	0.545	0.543	K2C4_MOUSE Keratin, type II cytoskeletal 4 OS=Mus musculus OX=10090 GN=Krt4 PE=1 SV=2
5	P13647	0.0	543	590	0.541	0.480	K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3
6	P19013	0.0	555	520	0.541	0.544	K2C4_HUMAN Keratin, type II cytoskeletal 4 OS=Homo sapiens OX=9606 GN=KRT4 PE=1 SV=5
7	P48668	0.0	543	564	0.547	0.507	K2C6C_HUMAN Keratin, type II cytoskeletal 6C OS=Homo sapiens OX=9606 GN=KRT6C PE=1 SV=3
8	P50446	0.0	543	553	0.482	0.456	K2C6A_MOUSE Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3
9	Q14CN4	0.0	693	511	0.734	0.751	K2C72_HUMAN Keratin, type II cytoskeletal 72 OS=Homo sapiens OX=9606 GN=KRT72 PE=1 SV=2
10	Q3SY84	0.0	1064	523	1.000	1.000	K2C71_HUMAN Keratin, type II cytoskeletal 71 OS=Homo sapiens OX=9606 GN=KRT71 PE=1 SV=3
11	Q5XKE5	0.0	547	535	0.512	0.501	K2C79_HUMAN Keratin, type II cytoskeletal 79 OS=Homo sapiens OX=9606 GN=KRT79 PE=1 SV=2
12	Q6P6Q2	0.0	532	576	0.484	0.439	K2C5_RAT Keratin, type II cytoskeletal 5 OS=Rattus norvegicus OX=10116 GN=Krt5 PE=1 SV=1
13	Q7RTS7	0.0	701	529	0.742	0.733	K2C74_HUMAN Keratin, type II cytoskeletal 74 OS=Homo sapiens OX=9606 GN=KRT74 PE=1 SV=2
14	Q86Y46	0.0	859	540	0.832	0.806	K2C73_HUMAN Keratin, type II cytoskeletal 73 OS=Homo sapiens OX=9606 GN=KRT73 PE=1 SV=1
15	Q8BGZ7	0.0	548	551	0.541	0.514	K2C75_MOUSE Keratin, type II cytoskeletal 75 OS=Mus musculus OX=10090 GN=Krt75 PE=1 SV=1
16	Q922U2	0.0	529	580	0.472	0.426	K2C5_MOUSE Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1
17	Q9R0H5	0.0	926	524	0.916	0.914	K2C71_MOUSE Keratin, type II cytoskeletal 71 OS=Mus musculus OX=10090 GN=Krt71 PE=1 SV=1
18	Q9Z331	0.0	539	562	0.478	0.445	K2C6B_MOUSE Keratin, type II cytoskeletal 6B OS=Mus musculus OX=10090 GN=Krt6b PE=1 SV=3
19	P04264	2.43e-180	523	644	0.474	0.385	K2C1_HUMAN Keratin, type II cytoskeletal 1 OS=Homo sapiens OX=9606 GN=KRT1 PE=1 SV=6
20	Q3UV17	2.16e-177	514	594	0.476	0.419	K22O_MOUSE Keratin, type II cytoskeletal 2 oral OS=Mus musculus OX=10090 GN=Krt76 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11839 Alanine_zipper	87	14.9	Alanine-zipper, major outer membrane lipoprotein
2	PF04513 Baculo_PEP_C	5.8	18.4	Baculovirus polyhedron envelope protein, PEP, C terminus
3	PF18035 Bap31_Bap29_C	20	16.6	Bap31/Bap29 cytoplasmic coiled-coil domain
4	PF10473 CENP-F_leu_zip	0.0078	27.7	Leucine-rich repeats of kinetochore protein Cenp-F/LEK1
5	PF07889 DUF1664	5.4e+02	12.0	Protein of unknown function (DUF1664)
6	PF16888 DUF5082	2e+02	13.7	Domain of unknown function (DUF5082)
7	PF00038 Filament	2.6e-100	347.7	Intermediate filament protein
8	PF16208 Keratin_2_head	9.1e-15	66.6	Keratin type II head
9	PF09728 Taxilin	12	16.6	Myosin-like coiled-coil protein
10	PF07926 TPR_MLP1_2	15	17.0	TPR/MLP1/MLP2-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000267119

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000311697	0.854	Fibroblast growth factor 5
2	9606.ENSP00000276659	0.815	R-spondin-2
3	9606.ENSP00000370047	0.681	Zinc finger protein basonuclin-2
4	9606.ENSP00000260264	0.658	POU domain, class 2, transcription factor 3
5	9606.ENSP00000257974	0.573	Keratin, type II cuticular Hb2
6	9606.ENSP00000257901	0.549	Keratin, type II cuticular Hb5
7	9606.ENSP00000310861	0.537	Keratin, type II cytoskeletal 2 epidermal
8	9606.ENSP00000293670	0.535	Keratin, type II cuticular Hb3
9	9606.ENSP00000367691	0.531	Lysophosphatidic acid receptor 6
10	9606.ENSP00000444533	0.529	Keratin, type II cuticular Hb6
11	9606.ENSP00000252242	0.528	Keratin, type II cytoskeletal 5
12	9606.ENSP00000330101	0.528	Keratin, type II cytoskeletal 2 oral
13	9606.ENSP00000342710	0.528	Keratin, type II cytoskeletal 1b
14	9606.ENSP00000257951	0.527	Keratin, type II cuticular Hb4
15	9606.ENSP00000413479	0.521	Keratin, type II cytoskeletal 3
16	9606.ENSP00000252244	0.520	Keratin, type II cytoskeletal 1
17	9606.ENSP00000328358	0.520	Keratin, type II cytoskeletal 79
18	9606.ENSP00000369349	0.520	Keratin, type II cuticular Hb1
19	9606.ENSP00000296252	0.519	Lipase member H
20	9606.ENSP00000306261	0.519	Keratin, type II cytoskeletal 78

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.730	structural molecule activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048856	0.987	anatomical structure development
GO:0009987	0.981	cellular process
GO:0008544	0.927	epidermis development
GO:0042633	0.889	hair cycle
GO:0045103	0.768	intermediate filament-based process
GO:0045104	0.761	intermediate filament cytoskeleton organization
GO:0022404	0.727	molting cycle process
GO:0043588	0.692	skin development
GO:0098773	0.680	skin epidermis development
GO:0048730	0.672	epidermis morphogenesis
GO:0065007	0.362	biological regulation
GO:0022405	0.349	hair cycle process
GO:0050789	0.322	regulation of biological process
GO:0050794	0.310	regulation of cellular process
GO:0001942	0.302	hair follicle development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005576	0.999	extracellular region
GO:0043229	0.997	intracellular organelle
GO:0045111	0.993	intermediate filament cytoskeleton
GO:0070062	0.987	extracellular exosome
GO:0099513	0.980	polymeric cytoskeletal fiber
GO:0005882	0.933	intermediate filament
GO:0045095	0.829	keratin filament
GO:0043231	0.768	intracellular membrane-bounded organelle
GO:0005634	0.370	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]