StarFunc result for job id Q3SYB3

User Input

>input (417 residues)
MNLPRAERLRSTPQRSLRDSDGEDGKIDVLGEEEDEDEVEDEEEAASQQFLEQSLQPGLQ
VARWGGVALPREHIEGGGGPSDPSEFGTKFRAPPRSAAASEDARQPAKPPYSYIALITMA
ILQNPHKRLTLSGICAFISGRFPYYRRKFPAWQNSIRHNLSLNDCFVKIPREPGHPGKGN
YWSLDPASQDMFDNGSFLRRRKRFKRHQLTPGAHLPHPFPLPAAHAALHNPHPGPLLGAP
APPQPVPGAYPNTAPGRRPYALLHPHPLRYLLLSAPVYAGAPKKAEGAALATPAPFPCCS
PHLVLSLGRRARVWRRHREADASLSALRVLCKGSGERVQGLRRVCPRPRGATATCSSDHQ
ACCIPRPLPLCCKCPPPPLLGQFCSNSSSIRRRTAPTAALPPRARCWAGTCRPRRPC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3SYB3	0.999	0.999	9.279E-67	417	1.000	1.000	Q3SYB3.pdb.gz	FX4L6_HUMAN Forkhead box protein D4-like 6 OS=Homo sapiens OX=9606 GN=FOXD4L6 PE=1 SV=2
2	AFDB:Q12950	0.452	0.430	1.787E-52	439	0.847	0.804	Q12950.pdb.gz	FOXD4_HUMAN Forkhead box protein D4 OS=Homo sapiens OX=9606 GN=FOXD4 PE=1 SV=4
3	AFDB:Q9NU39	0.380	0.388	4.131E-47	408	0.712	0.728	Q9NU39.pdb.gz	FX4L1_HUMAN Forkhead box protein D4-like 1 OS=Homo sapiens OX=9606 GN=FOXD4L1 PE=1 SV=1
4	AFDB:Q9PRJ8	0.278	0.328	4.662E-23	352	0.338	0.401	Q9PRJ8.pdb.gz	FXD5A_XENLA Forkhead box protein D5-A OS=Xenopus laevis OX=8355 GN=foxd5-a PE=2 SV=1
5	AFDB:Q16676	0.275	0.248	2.527E-22	465	0.398	0.357	Q16676.pdb.gz	FOXD1_HUMAN Forkhead box protein D1 OS=Homo sapiens OX=9606 GN=FOXD1 PE=1 SV=1
6	AFDB:B0UXI3	0.262	0.260	1.619E-20	422	0.312	0.308	B0UXI3.pdb.gz	B0UXI3_DANRE Forkhead box E3 OS=Danio rerio OX=7955 GN=foxe3 PE=2 SV=1
7	AFDB:Q9QY14	0.262	0.375	3.018E-19	288	0.295	0.427	Q9QY14.pdb.gz	FOXE3_MOUSE Forkhead box protein E3 OS=Mus musculus OX=10090 GN=Foxe3 PE=1 SV=1
8	AFDB:E7FER3	0.246	0.240	2.203E-17	429	0.223	0.217	E7FER3.pdb.gz	E7FER3_DANRE Forkhead box F2b OS=Danio rerio OX=7955 GN=foxf2b PE=4 SV=1
9	AFDB:Q61574	0.276	0.344	8.083E-17	329	0.257	0.325	Q61574.pdb.gz	FOXS1_MOUSE Forkhead box protein S1 OS=Mus musculus OX=10090 GN=Foxs1 PE=2 SV=2
10	AFDB:P34683	0.256	0.442	5.682E-16	237	0.199	0.350	P34683.pdb.gz	LIN31_CAEEL Protein lin-31 OS=Caenorhabditis elegans OX=6239 GN=lin-31 PE=4 SV=1
11	PDB:2hdcA	0.197	0.682	5.390E-12	97	0.206	0.887	2hdcA.pdb.gz	Dynamic DNA contacts observed in the NMR structure of winged helix protein-DNA complex.
12	PDB:5k1yD	0.130	0.472	5.312E-2	92	0.036	0.163	5k1yD.pdb.gz	Detailed structural analysis of AspA-DNA contacts
13	PDB:2nyxB	0.137	0.339	1.159E-1	147	0.026	0.075	2nyxB.pdb.gz
14	PDB:4a6dA	0.133	0.158	1.237E-1	345	0.024	0.029	4a6dA.pdb.gz	Crystal Structure and Functional Mapping of Human Asmt, the Last Enzyme of the Melatonin Synthesis Pathway.
15	PDB:6iwtA	0.138	0.163	1.503E-1	346	0.031	0.038	6iwtA.pdb.gz
16	PDB:3euhB	0.166	0.209	1.604E-1	321	0.024	0.031	3euhB.pdb.gz
17	PDB:5hs7A	0.128	0.401	1.711E-1	102	0.031	0.127	5hs7A.pdb.gz
18	PDB:7k5yU	0.147	0.622	1.711E-1	75	0.026	0.147	7k5yU.pdb.gz	Distinct Structures and Dynamics of Chromatosomes with Different Human Linker Histone Isoforms.
19	PDB:2fe3B	0.129	0.341	2.369E-1	143	0.019	0.056	2fe3B.pdb.gz	Crystal structure of the apo-PerR-Zn protein from Bacillus subtilis.
20	PDB:1xn7A	0.114	0.469	2.528E-1	78	0.036	0.192	1xn7A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q12950	0.0	635	439	0.820	0.779	FOXD4_HUMAN Forkhead box protein D4 OS=Homo sapiens OX=9606 GN=FOXD4 PE=1 SV=4
2	Q3SYB3	0.0	837	417	1.000	1.000	FX4L6_HUMAN Forkhead box protein D4-like 6 OS=Homo sapiens OX=9606 GN=FOXD4L6 PE=1 SV=2
3	Q6VB84	0.0	833	417	0.995	0.995	FX4L3_HUMAN Forkhead box protein D4-like 3 OS=Homo sapiens OX=9606 GN=FOXD4L3 PE=1 SV=2
4	Q8WXT5	0.0	811	416	0.978	0.981	FX4L4_HUMAN Forkhead box protein D4-like 4 OS=Homo sapiens OX=9606 GN=FOXD4L4 PE=1 SV=2
5	Q9NU39	0.0	511	408	0.681	0.696	FX4L1_HUMAN Forkhead box protein D4-like 1 OS=Homo sapiens OX=9606 GN=FOXD4L1 PE=1 SV=1
6	Q9DEN4	5.51e-57	193	371	0.240	0.270	FXD3A_XENLA Forkhead box protein D3-A OS=Xenopus laevis OX=8355 GN=foxd3-a PE=1 SV=1
7	Q9DEN3	6.66e-55	187	371	0.230	0.259	FXD3B_XENLA Forkhead box protein D3-B OS=Xenopus laevis OX=8355 GN=foxd3-b PE=2 SV=1
8	Q18694	1.70e-54	186	333	0.237	0.297	UN130_CAEEL Forkhead box protein unc-130 OS=Caenorhabditis elegans OX=6239 GN=unc-130 PE=1 SV=1
9	F1R5S7	1.27e-53	184	371	0.261	0.294	F1R5S7_DANRE Forkhead box protein D3 OS=Danio rerio OX=7955 GN=fkd-6 PE=1 SV=1
10	Q9PRJ8	1.04e-52	181	352	0.221	0.261	FXD5A_XENLA Forkhead box protein D5-A OS=Xenopus laevis OX=8355 GN=foxd5-a PE=2 SV=1
11	Q9PT68	2.02e-52	181	353	0.237	0.280	FXD5B_XENLA Forkhead box protein D5-B OS=Xenopus laevis OX=8355 GN=foxd5-b PE=2 SV=1
12	P79772	2.85e-52	181	394	0.218	0.231	FOXD3_CHICK Forkhead box protein D3 OS=Gallus gallus OX=9031 GN=FOXD3 PE=2 SV=1
13	Q61060	6.30e-52	182	465	0.218	0.196	FOXD3_MOUSE Forkhead box protein D3 OS=Mus musculus OX=10090 GN=Foxd3 PE=2 SV=3
14	O73784	7.67e-52	178	321	0.197	0.255	O73784_DANRE Fork head domain protein FKD8 OS=Danio rerio OX=7955 GN=fkd8 PE=2 SV=1
15	Q9UJU5	2.21e-51	181	478	0.218	0.190	FOXD3_HUMAN Forkhead box protein D3 OS=Homo sapiens OX=9606 GN=FOXD3 PE=1 SV=1
16	Q63245	6.28e-51	168	101	0.189	0.782	FOXD3_RAT Forkhead box protein D3 (Fragment) OS=Rattus norvegicus OX=10116 GN=Foxd3 PE=1 SV=1
17	Q16676	3.55e-50	177	465	0.192	0.172	FOXD1_HUMAN Forkhead box protein D1 OS=Homo sapiens OX=9606 GN=FOXD1 PE=1 SV=1
18	Q9PSY4	9.33e-50	173	345	0.187	0.226	FOXD1_XENLA Forkhead box protein D1 OS=Xenopus laevis OX=8355 GN=foxd1 PE=2 SV=2
19	Q61345	1.23e-49	176	456	0.189	0.173	FOXD1_MOUSE Forkhead box protein D1 OS=Mus musculus OX=10090 GN=Foxd1 PE=2 SV=2
20	O60548	1.27e-49	177	495	0.192	0.162	FOXD2_HUMAN Forkhead box protein D2 OS=Homo sapiens OX=9606 GN=FOXD2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00250 Forkhead	2.2e-32	122.4	Forkhead domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000484875

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000303111	0.611	Olfactory receptor 5AP2
2	9606.ENSP00000306607	0.610	Olfactory receptor 1L8
3	9606.ENSP00000396402	0.610	Zinc finger protein 793
4	9606.ENSP00000485212	0.601	Olfactory receptor 8B4
5	9606.ENSP00000367193	0.600	F-box protein 48
6	9606.ENSP00000361784	0.582	Zinc finger protein 684
7	9606.ENSP00000361544	0.566	Nucleoporin-62 C-terminal-like protein
8	9606.ENSP00000471000	0.536	Zinc finger protein 616
9	9606.ENSP00000315664	0.524	Zinc finger protein 18
10	9606.ENSP00000437616	0.524	Zinc finger protein 611
11	9606.ENSP00000436424	0.518	Olfactory receptor 4D10
12	9606.ENSP00000384621	0.512	ATP-dependent RNA helicase DQX1
13	9606.ENSP00000375248	0.504	Class A basic helix-loop-helix protein 9
14	9606.ENSP00000296824	0.501	Coiled-coil domain containing 127

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	0.923	DNA binding
GO:0140110	0.837	transcription regulator activity
GO:0003700	0.826	DNA-binding transcription factor activity
GO:0043565	0.708	sequence-specific DNA binding
GO:1990837	0.448	sequence-specific double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.985	regulation of cellular process
GO:0060255	0.960	regulation of macromolecule metabolic process
GO:0009987	0.919	cellular process
GO:0080090	0.865	regulation of primary metabolic process
GO:0051171	0.865	regulation of nitrogen compound metabolic process
GO:0031323	0.864	regulation of cellular metabolic process
GO:0010468	0.861	regulation of gene expression
GO:0006355	0.729	regulation of DNA-templated transcription
GO:0032502	0.720	developmental process
GO:0048518	0.669	positive regulation of biological process
GO:0009893	0.662	positive regulation of metabolic process
GO:0050896	0.651	response to stimulus
GO:0010604	0.649	positive regulation of macromolecule metabolic process
GO:0048856	0.641	anatomical structure development
GO:0006357	0.558	regulation of transcription by RNA polymerase II
GO:0048522	0.534	positive regulation of cellular process
GO:0051173	0.512	positive regulation of nitrogen compound metabolic process
GO:0031325	0.512	positive regulation of cellular metabolic process
GO:0051716	0.443	cellular response to stimulus
GO:0048519	0.425	negative regulation of biological process
GO:0048523	0.399	negative regulation of cellular process
GO:0045944	0.357	positive regulation of transcription by RNA polymerase II
GO:0007154	0.337	cell communication
GO:0032501	0.328	multicellular organismal process
GO:0023052	0.328	signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.605	nuclear lumen
GO:0005654	0.474	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]