StarFunc result for job id Q3SYC2

User Input

>input (334 residues)
MVEFAPLFMPWERRLQTLAVLQFVFSFLALAEICTVGFIALLFTRFWLLTVLYAAWWYLD
RDKPRQGGRHIQAIRCWTIWKYMKDYFPISLVKTAELDPSRNYIAGFHPHGVLAVGAFAN
LCTESTGFSSIFPGIRPHLMMLTLWFRAPFFRDYIMSAGLVTSEKESAAHILNRKGGGNL
LGIIVGGAQEALDARPGSFTLLLRNRKGFVRLALTHGAPLVPIFSFGENDLFDQIPNSSG
SWLRYIQNRLQKIMGISLPLFHGRGVFQYSFGLIPYRRPITTVVGKPIEVQKTLHPSEEE
VNQLHQRYIKELCNLFEAHKLKFNIPADQHLEFC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3SYC2	1.000	1.000	1.314E-71	334	1.000	1.000	Q3SYC2.pdb.gz	MOGT2_HUMAN 2-acylglycerol O-acyltransferase 2 OS=Homo sapiens OX=9606 GN=MOGAT2 PE=1 SV=2
2	AFDB:Q80W94	0.998	0.998	8.390E-63	334	0.811	0.811	Q80W94.pdb.gz	MOGT2_MOUSE 2-acylglycerol O-acyltransferase 2 OS=Mus musculus OX=10090 GN=Mogat2 PE=1 SV=1
3	AFDB:F1R0E7	0.994	0.903	4.196E-56	368	0.635	0.576	F1R0E7.pdb.gz	F1R0E7_DANRE Acyltransferase OS=Danio rerio OX=7955 GN=wu:fb94h05 PE=1 SV=1
4	AFDB:Q96PD6	0.976	0.974	3.052E-50	335	0.530	0.528	Q96PD6.pdb.gz	MOGT1_HUMAN 2-acylglycerol O-acyltransferase 1 OS=Homo sapiens OX=9606 GN=MOGAT1 PE=2 SV=2
5	AFDB:Q91ZV4	0.981	0.978	4.485E-49	335	0.530	0.528	Q91ZV4.pdb.gz	MOGT1_MOUSE 2-acylglycerol O-acyltransferase 1 OS=Mus musculus OX=10090 GN=Mogat1 PE=1 SV=2
6	AFDB:Q4V9F0	0.957	0.887	6.285E-46	361	0.461	0.427	Q4V9F0.pdb.gz	DGAT2_DANRE Diacylglycerol O-acyltransferase 2 OS=Danio rerio OX=7955 GN=dgat2 PE=2 SV=1
7	AFDB:Q5FVP8	0.954	0.822	4.077E-45	388	0.452	0.389	Q5FVP8.pdb.gz	DGAT2_RAT Diacylglycerol O-acyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Dgat2 PE=2 SV=1
8	AFDB:Q86VF5	0.953	0.934	1.474E-44	341	0.461	0.452	Q86VF5.pdb.gz	MOGT3_HUMAN 2-acylglycerol O-acyltransferase 3 OS=Homo sapiens OX=9606 GN=MOGAT3 PE=1 SV=1
9	AFDB:Q9XUW0	0.941	0.912	3.887E-43	345	0.440	0.426	Q9XUW0.pdb.gz	Q9XUW0_CAEEL Acyltransferase OS=Caenorhabditis elegans OX=6239 GN=dgat-2 PE=1 SV=1
10	AFDB:Q23067	0.964	0.898	9.338E-43	359	0.443	0.412	Q23067.pdb.gz	Q23067_CAEEL Acyltransferase OS=Caenorhabditis elegans OX=6239 GN=dgtr-1 PE=3 SV=1
11	PDB:5f2tB	0.294	0.361	1.200E-2	262	0.123	0.156	5f2tB.pdb.gz	Structural basis for selective recognition of acyl chains by the membrane-associated acyltransferase PatA.
12	PDB:6xoiB	0.160	0.141	9.275E-2	403	0.081	0.067	6xoiB.pdb.gz	Discovery of TAK-981, a First-in-Class Inhibitor of SUMO-Activating Enzyme for the Treatment of Cancer.
13	PDB:5xncB	0.155	0.149	1.242E-1	354	0.126	0.119	5xncB.pdb.gz	Active site geometry of a novel aminopropyltransferase for biosynthesis of hyperthermophile-specific branched-chain polyamine.
14	PDB:2vhhC	0.078	0.070	1.664E-1	382	0.054	0.047	2vhhC.pdb.gz
15	PDB:7q2dA	0.147	0.159	1.982E-1	286	0.081	0.094	7q2dA.pdb.gz	Fragment-Based Ligand Discovery Applied to the Mycolic Acid Methyltransferase Hma (MmaA4) from Mycobacterium tuberculosis : A Crystallographic and Molecular Modelling Study.
16	PDB:5l6iA	0.085	0.046	3.164E-1	1007	0.066	0.022	5l6iA.pdb.gz	Dissecting the Specificity of Adenosyl Sulfamate Inhibitors Targeting the Ubiquitin-Activating Enzyme.
17	PDB:7ou2A	0.198	0.111	3.354E-1	721	0.072	0.033	7ou2A.pdb.gz	Cryogenic electron microscopy structures reveal how ATP and DNA binding in MutS coordinates sequential steps of DNA mismatch repair.
18	PDB:1zfnA	0.145	0.183	3.996E-1	244	0.087	0.119	1zfnA.pdb.gz	Structural Analysis of Escherichia Coli ThiF.
19	PDB:7ezgA	0.140	0.157	4.237E-1	275	0.063	0.076	7ezgA.pdb.gz	Crystal structure of human METTL6, the m 3 C methyltransferase.
20	PDB:3kycB	0.130	0.090	4.492E-1	548	0.048	0.029	3kycB.pdb.gz	Active site remodelling accompanies thioester bond formation in the SUMO E1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3SYC2	0.0	690	334	1.000	1.000	MOGT2_HUMAN 2-acylglycerol O-acyltransferase 2 OS=Homo sapiens OX=9606 GN=MOGAT2 PE=1 SV=2
2	Q80W94	0.0	572	334	0.811	0.811	MOGT2_MOUSE 2-acylglycerol O-acyltransferase 2 OS=Mus musculus OX=10090 GN=Mogat2 PE=1 SV=1
3	F1R0E7	7.38e-163	461	368	0.635	0.576	F1R0E7_DANRE Acyltransferase OS=Danio rerio OX=7955 GN=wu:fb94h05 PE=1 SV=1
4	Q91ZV4	1.75e-132	382	335	0.530	0.528	MOGT1_MOUSE 2-acylglycerol O-acyltransferase 1 OS=Mus musculus OX=10090 GN=Mogat1 PE=1 SV=2
5	Q96PD6	3.75e-132	381	335	0.530	0.528	MOGT1_HUMAN 2-acylglycerol O-acyltransferase 1 OS=Homo sapiens OX=9606 GN=MOGAT1 PE=2 SV=2
6	F1QSW7	3.18e-127	366	252	0.494	0.655	F1QSW7_DANRE 2-acylglycerol O-acyltransferase 2 isoform 2 OS=Danio rerio OX=7955 GN=wu:fb94h05 PE=1 SV=1
7	Q96PD7	6.50e-111	329	388	0.452	0.389	DGAT2_HUMAN Diacylglycerol O-acyltransferase 2 OS=Homo sapiens OX=9606 GN=DGAT2 PE=1 SV=2
8	Q70VZ8	3.69e-110	327	361	0.449	0.416	DGAT2_BOVIN Diacylglycerol O-acyltransferase 2 OS=Bos taurus OX=9913 GN=DGAT2 PE=2 SV=1
9	Q9DCV3	4.04e-110	327	388	0.452	0.389	DGAT2_MOUSE Diacylglycerol O-acyltransferase 2 OS=Mus musculus OX=10090 GN=Dgat2 PE=1 SV=1
10	Q5FVP8	7.93e-110	327	388	0.452	0.389	DGAT2_RAT Diacylglycerol O-acyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Dgat2 PE=2 SV=1
11	Q4V9F0	3.33e-109	324	361	0.461	0.427	DGAT2_DANRE Diacylglycerol O-acyltransferase 2 OS=Danio rerio OX=7955 GN=dgat2 PE=2 SV=1
12	Q86VF5	2.20e-101	303	341	0.461	0.452	MOGT3_HUMAN 2-acylglycerol O-acyltransferase 3 OS=Homo sapiens OX=9606 GN=MOGAT3 PE=1 SV=1
13	Q23067	1.30e-100	302	359	0.452	0.421	Q23067_CAEEL Acyltransferase OS=Caenorhabditis elegans OX=6239 GN=dgtr-1 PE=3 SV=1
14	Q54GC1	1.53e-99	298	330	0.410	0.415	DGAT2_DICDI Diacylglycerol O-acyltransferase 2 OS=Dictyostelium discoideum OX=44689 GN=dgat2 PE=3 SV=1
15	Q9XUW0	1.13e-97	294	345	0.437	0.423	Q9XUW0_CAEEL Acyltransferase OS=Caenorhabditis elegans OX=6239 GN=dgat-2 PE=1 SV=1
16	Q6ZPD8	1.22e-93	283	337	0.434	0.430	DG2L6_HUMAN Diacylglycerol O-acyltransferase 2-like protein 6 OS=Homo sapiens OX=9606 GN=DGAT2L6 PE=1 SV=1
17	Q6E213	1.16e-92	281	333	0.419	0.420	AWAT2_HUMAN Acyl-CoA wax alcohol acyltransferase 2 OS=Homo sapiens OX=9606 GN=AWAT2 PE=1 SV=1
18	Q6E1M8	7.19e-92	279	333	0.413	0.414	AWAT2_MOUSE Acyl-CoA wax alcohol acyltransferase 2 OS=Mus musculus OX=10090 GN=Awat2 PE=1 SV=1
19	Q58HT5	9.89e-92	278	328	0.437	0.445	AWAT1_HUMAN Acyl-CoA wax alcohol acyltransferase 1 OS=Homo sapiens OX=9606 GN=AWAT1 PE=1 SV=1
20	O74850	1.73e-75	237	345	0.368	0.357	DGAT2_SCHPO Diacylglycerol O-acyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dga1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03982 DAGAT	3.9e-115	395.5	Diacylglycerol acyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000198801

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000482264	0.992	Diacylglycerol O-acyltransferase 1
2	9606.ENSP00000265052	0.943	Monoglyceride lipase
3	9606.ENSP00000381302	0.923	Phospholipid phosphatase 4
4	9606.ENSP00000392553	0.923	Phospholipid phosphatase 5
5	9606.ENSP00000228027	0.917	Diacylglycerol O-acyltransferase 2
6	9606.ENSP00000309757	0.912	Lipoprotein lipase
7	9606.ENSP00000347581	0.909	Acylglycerol kinase, mitochondrial
8	9606.ENSP00000223114	0.908	2-acylglycerol O-acyltransferase 3
9	9606.ENSP00000219345	0.828	Group XV phospholipase A2
10	9606.ENSP00000261596	0.809	Phosphatidate phosphatase LPIN2
11	9606.ENSP00000406674	0.808	2-acylglycerol O-acyltransferase 1
12	9606.ENSP00000362354	0.801	Phosphatidate phosphatase LPIN3
13	9606.ENSP00000397908	0.778	Phosphatidate phosphatase LPIN1
14	9606.ENSP00000337701	0.768	Patatin-like phospholipase domain-containing protein 2
15	9606.ENSP00000358223	0.752	Pancreatic lipase
16	9606.ENSP00000385780	0.749	Diacylglycerol kinase beta
17	9606.ENSP00000329697	0.748	Phospholipid phosphatase 2
18	9606.ENSP00000216180	0.747	Patatin-like phospholipase domain-containing protein 3
19	9606.ENSP00000377900	0.745	Lipase F, gastric type
20	9606.ENSP00000299022	0.739	Hepatic triacylglycerol lipase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016411	1.000	acylglycerol O-acyltransferase activity
GO:0004144	0.968	diacylglycerol O-acyltransferase activity
GO:0005488	0.806	binding
GO:0005515	0.799	protein binding
GO:0003846	0.794	2-acylglycerol O-acyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.999	cellular metabolic process
GO:0071704	0.998	organic substance metabolic process
GO:0044238	0.998	primary metabolic process
GO:0044249	0.989	cellular biosynthetic process
GO:0006639	0.987	acylglycerol metabolic process
GO:0019432	0.980	triglyceride biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005783	1.000	endoplasmic reticulum
GO:0098827	0.994	endoplasmic reticulum subcompartment
GO:0031090	0.988	organelle membrane
GO:0005789	0.980	endoplasmic reticulum membrane
GO:0097038	0.609	perinuclear endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.1.-	1.000	Transferring groups other than amino-acyl groups.
RHEA:10868	0.968	a 1,2-diacyl-sn-glycerol + an acyl-CoA = a triacyl-sn-glycerol + CoA
EC:2.3.1.20	0.968	diacylglycerol O-acyltransferase.
RHEA:16741	0.794	a 2-acylglycerol + an acyl-CoA = a 1,2-diacylglycerol + CoA
EC:2.3.1.22	0.794	2-acylglycerol O-acyltransferase.

[back to server]