StarFunc result for job id Q3T8J9

User Input

>input (2241 residues)
MLPCKKRRTTVTESLQHKGNQEENNVDLESAVKPESDQVKDLSSVSLSWDPSHGRVAGFE
VQSLQDAGNQLGMEDTSLSSGMLTQNTNVPILEGVDVAISQGITLPSLESFHPLNIHIGK
GKLHATGSKRGKKMTLRPGPVTQEDRCDHLTLKEPFSGEPSEEVKEEGGKPQMNSEGEIP
SLPSGSQSAKPVSQPRKSTQPDVCASPQEKPLRTLFHQPEEEIEDGGLFIPMEEQDNEES
EKRRKKKKGTKRKRDGRGQEGTLAYDLKLDDMLDRTLEDGAKQHNLTAVNVRNILHEVIT
NEHVVAMMKAAISETEDMPMFEPKMTRSKLKEVVEKGVVIPTWNISPIKKANEIKPPQFV
DIHLEEDDSSDEEYQPDDEEEDETAEESLLESDVESTASSPRGAKKSRLRQSSEMTETDE
ESGILSEAEKVTTPAIRHISAEVVPMGPPPPPKPKQTRDSTFMEKLHAVDEELASSPVCM
DSFQPMDDSLIAFRTRSKMPLKDVPLGQLEAELQAPDITPDMYDPNTADDEDWKMWLGGL
MNDDVGNEDEADDDDDPEYNFLEDLDEPDTEDFRTDRAVRITKKEVNELMEELFETFQDE
MGFSNMEDDGPEEEECVAEPRPNFNTPQALRFEEPLANLLNEQHRTVKELFEQLKMKKSS
AKQLQEVEKVKPQSEKVHQTLILDPAQRKRLQQQMQQHVQLLTQIHLLATCNPNLNPEAT
TTRIFLKELGTFAQSSIALHHQYNPKFQTLFQPCNLMGAMQLIEDFSTHVSIDCSPHKTV
KKTANEFPCLPKQVAWILATSKVFMYPELLPVCSLKAKNPQDKIVFTKAEDNLLALGLKH
FEGTEFPNPLISKYLLTCKTAHQLTVRIKNLNMNRAPDNIIKFYKKTKQLPVLGKCCEEI
QPHQWKPPIEREEHRLPFWLKASLPSIQEELRHMADGAREVGNMTGTTEINSDRSLEKDN
LELGSESRYPLLLPKGVVLKLKPVATRFPRKAWRQKRSSVLKPLLIQPSPSLQPSFNPGK
TPARSTHSEAPPSKMVLRIPHPIQPATVLQTVPGVPPLGVSGGESFESPAALPAVPPEAR
TSFPLSESQTLLSSAPVPKVMLPSLAPSKFRKPYVRRRPSKRRGVKASPCMKPAPVIHHP
ASVIFTVPATTVKIVSLGGGCNMIQPVNAAVAQSPQTIPITTLLVNPTSFPCPLNQSLVA
SSVSPLIVSGNSVNLPIPSTPEDKAHVNVDIACAVADGENAFQGLEPKLEPQELSPLSAT
VFPKVEHSPGPPLADAECQEGLSENSACRWTVVKTEEGRQALEPLPQGIQESLNNPTPGD
LEEIVKMEPEEAREEISGSPERDICDDIKVEHAVELDTGAPSEELSSAGEVTKQTVLQKE
EERSQPTKTPSSSQEPPDEGTSGTDVNKGSSKNALSSMDPEVRLSSPPGKPEDSSSVDGQ
SVGTPVGPETGGEKNGPEEEEEEDFDDLTQDEEDEMSSASEESVLSVPELQETMEKLTWL
ASERRMSQEGESEEENSQEENSEPEEEEEEEAEGMESLQKEDEMTDEAVGDSAEKPPTFA
SPETAPEVETSRTPPGESIKAAGKGRNNHRARNKRGSRARASKDTSKLLLLYDEDILERD
PLREQKDLAFAQAYLTRVREALQHIPGKYEDFLQVIYEFESSTQRRTAVDLYKSLQILLQ
DWPQLLKDFAAFLLPEQALACGLFEEQQAFEKSRKFLRQLEICFAENPSHHQKIIKVLQG
CADCLPQEITELKTQMWQLLKGHDHLQDEFSIFFDHLRPAASRMGDFEEINWTEEKEYEF
DGFEEVALPDVEEEEEPPKIPTASKNKRKKEIGVQNHDKETEWPDGAKDCACSCHEGGPD
SKLKKSKRRSCSHCSSKVCDSKSYKSKEPHELVGSSPHREASPMPGAKEAGQGKDMMEEE
APEERESTEATQSRTVRTTRKGEMPVSAGLAVGSTLPSPREVTVTERLLLDGPPPHSPET
PQFPPTTGAVLYTVKRNQVGPEVRSCPKASPRLQKEREGQKAVSESEALMLVWDASETEK
LPGTVEPPASFLSPVSSKTRDAGRRHVSGKPDTQERWLPSSRARVKTRDRTCPVHESPSG
IDTSETSPKAPRGGLAKDSGTQAKGPEGEQQPKAAEATVCANNSKVSSTGEKVVLWTREA
DRVILTMCQEQGAQPQTFNIISQQLGNKTPAEVSHRFRELMQLFHTACEASSEDEDDATS
TSNADQLSDHGDLLSEEELDE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3T8J9	1.000	1.000	0.000	2241	1.000	1.000	Q3T8J9.pdb.gz	GON4L_HUMAN GON-4-like protein OS=Homo sapiens OX=9606 GN=GON4L PE=1 SV=1
2	AFDB:Q9DB00	0.334	0.332	0.000	2260	0.753	0.746	Q9DB00.pdb.gz	GON4L_MOUSE GON-4-like protein OS=Mus musculus OX=10090 GN=Gon4l PE=1 SV=3
3	AFDB:F1QI87	0.251	0.271	1.616E-92	2055	0.358	0.391	F1QI87.pdb.gz	F1QI87_DANRE GON-4-like protein OS=Danio rerio OX=7955 GN=fb99g07 PE=4 SV=1
4	AFDB:F4IZM8	0.039	0.054	1.182E-4	1347	0.085	0.141	F4IZM8.pdb.gz	HUAL3_ARATH Protein HUA2-LIKE 3 OS=Arabidopsis thaliana OX=3702 GN=HULK3 PE=2 SV=1
5	AFDB:Q9Z1Q1	0.034	0.039	1.302E-4	1818	0.130	0.160	Q9Z1Q1.pdb.gz	NEST_MESAU Nestin (Fragments) OS=Mesocricetus auratus OX=10036 GN=NES PE=1 SV=2
6	AFDB:F4IN78	0.035	0.049	1.003E-3	1366	0.076	0.124	F4IN78.pdb.gz	HUAL2_ARATH Protein HUA2-LIKE 2 OS=Arabidopsis thaliana OX=3702 GN=HULK2 PE=2 SV=2
7	AFDB:Q9P227	0.034	0.044	1.053E-3	1491	0.101	0.152	Q9P227.pdb.gz	RHG23_HUMAN Rho GTPase-activating protein 23 OS=Homo sapiens OX=9606 GN=ARHGAP23 PE=1 SV=2
8	AFDB:Q9VN82	0.033	0.034	1.886E-3	2051	0.075	0.082	Q9VN82.pdb.gz	Q9VN82_DROME Canoe, isoform E OS=Drosophila melanogaster OX=7227 GN=cno PE=1 SV=2
9	AFDB:Q9QX47	0.028	0.027	2.651E-3	2444	0.128	0.117	Q9QX47.pdb.gz	SON_MOUSE Protein SON OS=Mus musculus OX=10090 GN=Son PE=1 SV=2
10	AFDB:P18583	0.028	0.026	4.105E-3	2426	0.132	0.122	P18583.pdb.gz	SON_HUMAN Protein SON OS=Homo sapiens OX=9606 GN=SON PE=1 SV=4
11	PDB:7aoaD	0.026	0.125	2.289	343	0.014	0.090	7aoaD.pdb.gz	The topology of chromatin-binding domains in the NuRD deacetylase complex.
12	PDB:2hi3A	0.023	0.441	2.780	73	0.004	0.110	2hi3A.pdb.gz
13	PDB:5wqlA	0.030	0.151	3.064	270	0.015	0.122	5wqlA.pdb.gz	Structural basis of adaptor-mediated protein degradation by the tail-specific PDZ-protease Prc
14	PDB:6sn1B	0.022	0.070	3.722	503	0.007	0.032	6sn1B.pdb.gz
15	PDB:7ktsD	0.032	0.126	4.102	219	0.010	0.105	7ktsD.pdb.gz
16	PDB:7q83D	0.022	0.172	4.102	156	0.011	0.154	7q83D.pdb.gz
17	PDB:6sgaF7	0.031	0.076	4.306	662	0.008	0.029	6sgaF7.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
18	PDB:7qe7Y	0.034	0.087	4.306	502	0.011	0.050	7qe7Y.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
19	PDB:1dceA	0.028	0.068	4.745	567	0.012	0.049	1dceA.pdb.gz	Crystal structure of Rab geranylgeranyltransferase at 2.0 A resolution.
20	PDB:2cjjA	0.024	0.677	4.982	63	0.003	0.111	2cjjA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WUE6	0.0	3042	1542	0.665	0.967	A0A087WUE6_HUMAN GON-4-like protein OS=Homo sapiens OX=9606 GN=GON4L PE=1 SV=1
2	A4PB68	0.0	1942	970	0.419	0.968	A4PB68_HUMAN YY1AP-related protein2 OS=Homo sapiens OX=9606 PE=1 SV=1
3	B0QZ55	0.0	635	495	0.141	0.640	B0QZ55_HUMAN YY1 associated protein 1 OS=Homo sapiens OX=9606 GN=YY1AP1 PE=1 SV=1
4	Q3T8J9	0.0	4583	2241	1.000	1.000	GON4L_HUMAN GON-4-like protein OS=Homo sapiens OX=9606 GN=GON4L PE=1 SV=1
5	Q9DB00	0.0	3033	2260	0.754	0.748	GON4L_MOUSE GON-4-like protein OS=Mus musculus OX=10090 GN=Gon4l PE=1 SV=3
6	Q9H869	0.0	1360	796	0.305	0.859	YYAP1_HUMAN YY1-associated protein 1 OS=Homo sapiens OX=9606 GN=YY1AP1 PE=1 SV=2
7	F1QI87	5.11e-153	528	2055	0.184	0.201	F1QI87_DANRE GON-4-like protein OS=Danio rerio OX=7955 GN=fb99g07 PE=4 SV=1
8	A8DYH1	5.33e-09	64.3	1739	0.022	0.028	A8DYH1_DROME Muscle wasted, isoform C OS=Drosophila melanogaster OX=7227 GN=mute PE=4 SV=1
9	Q8MS31	6.51e-09	63.5	665	0.022	0.074	Q8MS31_DROME Muscle wasted, isoform D OS=Drosophila melanogaster OX=7227 GN=mute PE=2 SV=1
10	Q9UKL3	9.33e-08	60.5	1982	0.015	0.017	C8AP2_HUMAN CASP8-associated protein 2 OS=Homo sapiens OX=9606 GN=CASP8AP2 PE=1 SV=1
11	A5JYS9	4.34e-06	54.7	1287	0.021	0.037	A5JYS9_CAEEL GON-4-like protein OS=Caenorhabditis elegans OX=6239 GN=gon-4 PE=1 SV=1
12	Q21216	5.93e-06	54.3	1338	0.021	0.036	Q21216_CAEEL GON-4-like protein OS=Caenorhabditis elegans OX=6239 GN=gon-4 PE=1 SV=2
13	Q9WUF3	1.01e-05	53.5	1962	0.013	0.015	C8AP2_MOUSE CASP8-associated protein 2 OS=Mus musculus OX=10090 GN=Casp8ap2 PE=1 SV=2
14	D4A7V6	5.14e-05	51.2	1962	0.011	0.013	D4A7V6_RAT Caspase 8 associated protein 2 OS=Rattus norvegicus OX=10116 GN=Casp8ap2 PE=1 SV=1
15	Q9SRH9	0.004	45.1	1372	0.017	0.027	SNL1_ARATH Paired amphipathic helix protein Sin3-like 1 OS=Arabidopsis thaliana OX=3702 GN=SNL1 PE=1 SV=2
16	O48686	0.018	42.7	1330	0.017	0.029	SNL3_ARATH Paired amphipathic helix protein Sin3-like 3 OS=Arabidopsis thaliana OX=3702 GN=SNL3 PE=1 SV=3
17	B2GVM8	0.047	40.4	245	0.019	0.171	B2GVM8_ARATH At1g24230 OS=Arabidopsis thaliana OX=3702 GN=At1g24230 PE=1 SV=1
18	Q20435	1.6	36.2	589	0.016	0.061	ATF6H_CAEEL Transcription factor atf-6 homolog OS=Caenorhabditis elegans OX=6239 GN=atf-6 PE=1 SV=2
19	P47110	2.3	35.4	350	0.011	0.071	DPOD3_YEAST DNA polymerase delta subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=POL32 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07863 CtnDOT_TraJ	1.6e+02	14.4	Homologues of TraJ from Bacteroides conjugative transposon
2	PF10982 DUF2789	5.5e+02	12.1	Protein of unknown function (DUF2789)
3	PF00249 Myb_DNA-binding	7.1	18.2	Myb-like DNA-binding domain
4	PF13921 Myb_DNA-bind_6	0.15	23.7	Myb-like DNA-binding domain
5	PF02671 PAH	4.4e-06	38.0	Paired amphipathic helix repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357315

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376204	0.910	Histone-lysine N-methyltransferase ASH1L
2	9606.ENSP00000378402	0.858	Paired amphipathic helix protein Sin3a
3	9606.ENSP00000380559	0.662	Crm, cramped-like (Drosophila)
4	9606.ENSP00000434024	0.638	Histone H2AX
5	9606.ENSP00000271732	0.631	Golgi phosphoprotein 3-like
6	9606.ENSP00000312618	0.614	Acyl-CoA dehydrogenase family member 9, mitochondrial
7	9606.ENSP00000414517	0.566	Mastermind-like domain-containing protein 1
8	9606.ENSP00000311447	0.560	Aspartate beta-hydroxylase domain containing 1
9	9606.ENSP00000029410	0.533	Beta-1,4-galactosyltransferase 7
10	9606.ENSP00000194130	0.528	Solute carrier family 13 member 1
11	9606.ENSP00000342144	0.520	Limbin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003714	1.000	transcription corepressor activity
GO:0003676	0.619	nucleic acid binding
GO:0003677	0.371	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0050794	0.978	regulation of cellular process
GO:0080090	0.897	regulation of primary metabolic process
GO:0048856	0.890	anatomical structure development
GO:0060255	0.889	regulation of macromolecule metabolic process
GO:0051171	0.889	regulation of nitrogen compound metabolic process
GO:0032501	0.854	multicellular organismal process
GO:0031323	0.850	regulation of cellular metabolic process
GO:0010556	0.801	regulation of macromolecule biosynthetic process
GO:0031326	0.801	regulation of cellular biosynthetic process
GO:0048523	0.789	negative regulation of cellular process
GO:0006355	0.683	regulation of DNA-templated transcription
GO:0030154	0.441	cell differentiation
GO:0051172	0.390	negative regulation of nitrogen compound metabolic process
GO:0010605	0.381	negative regulation of macromolecule metabolic process
GO:0001775	0.380	cell activation
GO:0030097	0.374	hemopoiesis
GO:1902679	0.369	negative regulation of RNA biosynthetic process
GO:0045892	0.358	negative regulation of DNA-templated transcription
GO:0008152	0.309	metabolic process
GO:0071704	0.303	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016604	0.999	nuclear body
GO:0005737	0.492	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]