StarFunc result for job id Q3T906

User Input

>input (1256 residues)
MLFKLLQRQTYTCLSHRYGLYVCFLGVVVTIVSAFQFGEVVLEWSRDQYHVLFDSYRDNI
AGKSFQNRLCLPMPIDVVYTWVNGTDLELLKELQQVREQMEEEQKAMREILGKNTTEPTK
KSEKQLECLLTHCIKVPMLVLDPALPANITLKDLPSLYPSFHSASDIFNVAKPKNPSTNV
SVVVFDSTKDVEDAHSGLLKGNSRQTVWRGYLTTDKEVPGLVLMQDLAFLSGFPPTFKET
NQLKTKLPENLSSKVKLLQLYSEASVALLKLNNPKDFQELNKQTKKNMTIDGKELTISPA
YLLWDLSAISQSKQDEDISASRFEDNEELRYSLRSIERHAPWVRNIFIVTNGQIPSWLNL
DNPRVTIVTHQDVFRNLSHLPTFSSPAIESHIHRIEGLSQKFIYLNDDVMFGKDVWPDDF
YSHSKGQKVYLTWPVPNCAEGCPGSWIKDGYCDKACNNSACDWDGGDCSGNSGGSRYIAG
GGGTGSIGVGQPWQFGGGINSVSYCNQGCANSWLADKFCDQACNVLSCGFDAGDCGQDHF
HELYKVILLPNQTHYIIPKGECLPYFSFAEVAKRGVEGAYSDNPIIRHASIANKWKTIHL
IMHSGMNATTIHFNLTFQNTNDEEFKMQITVEVDTREGPKLNSTAQKGYENLVSPITLLP
EAEILFEDIPKEKRFPKFKRHDVNSTRRAQEEVKIPLVNISLLPKDAQLSLNTLDLQLEH
GDITLKGYNLSKSALLRSFLMNSQHAKIKNQAIITDETNDSLVAPQEKQVHKSILPNSLG
VSERLQRLTFPAVSVKVNGHDQGQNPPLDLETTARFRVETHTQKTIGGNVTKEKPPSLIV
PLESQMTKEKKITGKEKENSRMEENAENHIGVTEVLLGRKLQHYTDSYLGFLPWEKKKYF
QDLLDEEESLKTQLAYFTDSKNTGRQLKDTFADSLRYVNKILNSKFGFTSRKVPAHMPHM
IDRIVMQELQDMFPEEFDKTSFHKVRHSEDMQFAFSYFYYLMSAVQPLNISQVFDEVDTD
QSGVLSDREIRTLATRIHELPLSLQDLTGLEHMLINCSKMLPADITQLNNIPPTQESYYD
PNLPPVTKSLVTNCKPVTDKIHKAYKDKNKYRFEIMGEEEIAFKMIRTNVSHVVGQLDDI
RKNPRKFVCLNDNIDHNHKDAQTVKAVLRDFYESMFPIPSQFELPREYRNRFLHMHELQE
WRAYRDKLKFWTHCVLATLIMFTIFSFFAEQLIALKRKIFPRRRIHKEASPNRIRV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3T906	1.000	1.000	0.000	1256	1.000	1.000	Q3T906.pdb.gz	GNPTA_HUMAN N-acetylglucosamine-1-phosphotransferase subunits alpha/beta OS=Homo sapiens OX=9606 GN=GNPTAB PE=1 SV=1
2	AFDB:Q5RGJ8	0.685	0.704	0.000	1219	0.639	0.659	Q5RGJ8.pdb.gz	GNPTA_DANRE N-acetylglucosamine-1-phosphotransferase subunits alpha/beta OS=Danio rerio OX=7955 GN=gnptab PE=1 SV=1
3	AFDB:Q69ZN6	0.642	0.652	0.000	1235	0.862	0.877	Q69ZN6.pdb.gz	GNPTA_MOUSE N-acetylglucosamine-1-phosphotransferase subunits alpha/beta OS=Mus musculus OX=10090 GN=Gnptab PE=2 SV=2
4	AFDB:Q54MP1	0.441	0.447	5.124E-65	1238	0.269	0.273	Q54MP1.pdb.gz	Q54MP1_DICDI LNR domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=gpt1 PE=1 SV=1
5	PDB:7s06A	0.318	0.846	5.364E-49	459	0.360	0.985	7s06A.pdb.gz
6	PDB:7s05B	0.318	0.889	6.776E-48	437	0.348	1.000	7s05B.pdb.gz	Structure of the human GlcNAc-1-phosphotransferase alpha beta subunits reveals regulatory mechanism for lysosomal enzyme glycan phosphorylation.
7	PDB:5vsuA	0.066	0.174	1.374E-4	387	0.016	0.052	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
8	PDB:7oqcF	0.059	0.239	8.155E-4	267	0.018	0.082	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
9	PDB:6y5qq	0.052	0.297	1.256E-3	178	0.020	0.140	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
10	PDB:5lsbA	0.069	0.311	1.399E-3	176	0.017	0.119	5lsbA.pdb.gz
11	PDB:7evoD	0.052	0.269	1.736E-3	200	0.021	0.135	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
12	PDB:6y53o	0.051	0.310	5.689E-3	160	0.018	0.138	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
13	PDB:6cjzA	0.046	0.302	6.689E-3	105	0.010	0.114	6cjzA.pdb.gz
14	PDB:5n0zA	0.059	0.110	1.087E-2	638	0.012	0.024	5n0zA.pdb.gz	Development of a Selective Inhibitor of Protein Arginine Deiminase 2.
15	AFDB:Q6IEE6	0.044	0.051	2.364E-2	1074	0.035	0.041	Q6IEE6.pdb.gz	T132E_MOUSE Transmembrane protein 132E OS=Mus musculus OX=10090 GN=Tmem132e PE=1 SV=2
16	AFDB:Q5D892	0.029	0.032	2.495E-2	1133	0.033	0.036	Q5D892.pdb.gz	MER3_ARATH DExH-box ATP-dependent RNA helicase DExH17 OS=Arabidopsis thaliana OX=3702 GN=MER3 PE=2 SV=1
17	AFDB:Q20870	0.065	0.153	5.605E-2	499	0.056	0.140	Q20870.pdb.gz	DAZ1_CAEEL DAZ protein 1 OS=Caenorhabditis elegans OX=6239 GN=daz-1 PE=2 SV=3
18	AFDB:Q9Y5I3	0.051	0.065	6.590E-2	950	0.034	0.045	Q9Y5I3.pdb.gz	PCDA1_HUMAN Protocadherin alpha-1 OS=Homo sapiens OX=9606 GN=PCDHA1 PE=2 SV=1
19	AFDB:Q9Y5I2	0.052	0.066	8.178E-2	948	0.034	0.045	Q9Y5I2.pdb.gz	PCDAA_HUMAN Protocadherin alpha-10 OS=Homo sapiens OX=9606 GN=PCDHA10 PE=2 SV=1
20	AFDB:Q02413	0.056	0.066	9.615E-2	1049	0.038	0.046	Q02413.pdb.gz	DSG1_HUMAN Desmoglein-1 OS=Homo sapiens OX=9606 GN=DSG1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3T906	0.0	2629	1256	1.000	1.000	GNPTA_HUMAN N-acetylglucosamine-1-phosphotransferase subunits alpha/beta OS=Homo sapiens OX=9606 GN=GNPTAB PE=1 SV=1
2	Q5RGJ8	0.0	1637	1219	0.644	0.664	GNPTA_DANRE N-acetylglucosamine-1-phosphotransferase subunits alpha/beta OS=Danio rerio OX=7955 GN=gnptab PE=1 SV=1
3	Q69ZN6	0.0	2225	1235	0.862	0.877	GNPTA_MOUSE N-acetylglucosamine-1-phosphotransferase subunits alpha/beta OS=Mus musculus OX=10090 GN=Gnptab PE=2 SV=2
4	Q54MP1	6.18e-87	310	1238	0.117	0.119	Q54MP1_DICDI LNR domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=gpt1 PE=1 SV=1
5	P9WGD1	2.92e-21	101	532	0.042	0.100	CPSY_MYCTU Exopolysaccharide phosphotransferase CpsY OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cpsY PE=1 SV=1
6	Q9W737	1.65e-04	48.5	1194	0.034	0.036	Q9W737_CHICK NOTCH-1 (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
7	P14585	1.84e-04	48.5	1429	0.029	0.025	LIN12_CAEEL Protein lin-12 OS=Caenorhabditis elegans OX=6239 GN=lin-12 PE=1 SV=1
8	Q04721	3.03e-04	47.8	2471	0.033	0.017	NOTC2_HUMAN Neurogenic locus notch homolog protein 2 OS=Homo sapiens OX=9606 GN=NOTCH2 PE=1 SV=3
9	O35516	3.41e-04	47.8	2473	0.033	0.017	NOTC2_MOUSE Neurogenic locus notch homolog protein 2 OS=Mus musculus OX=10090 GN=Notch2 PE=1 SV=2
10	A0PGH6	7.98e-04	46.6	2465	0.029	0.015	A0PGH6_DANRE Neurogenic locus notch homolog protein 1 OS=Danio rerio OX=7955 GN=wu:fc55e11 PE=2 SV=1
11	Q9QW30	0.001	46.2	2471	0.029	0.015	NOTC2_RAT Neurogenic locus notch homolog protein 2 OS=Rattus norvegicus OX=10116 GN=Notch2 PE=1 SV=1
12	Q9UM47	0.012	42.7	2321	0.028	0.015	NOTC3_HUMAN Neurogenic locus notch homolog protein 3 OS=Homo sapiens OX=9606 GN=NOTCH3 PE=1 SV=2
13	Q800E4	0.033	41.2	2468	0.032	0.016	Q800E4_DANRE Neurogenic locus notch homolog protein 3 precursor OS=Danio rerio OX=7955 GN=fa14b08 PE=1 SV=1
14	P13508	0.037	40.8	1295	0.025	0.025	GLP1_CAEEL Protein glp-1 OS=Caenorhabditis elegans OX=6239 GN=glp-1 PE=1 SV=1
15	G3I6Z6	0.050	40.4	2527	0.023	0.011	NOTC1_CRIGR Neurogenic locus notch homolog protein 1 OS=Cricetulus griseus OX=10029 GN=NOTCH1 PE=1 SV=2
16	Q99466	0.050	40.4	2003	0.033	0.020	NOTC4_HUMAN Neurogenic locus notch homolog protein 4 OS=Homo sapiens OX=9606 GN=NOTCH4 PE=1 SV=2
17	P31695	0.14	39.3	1964	0.010	0.007	NOTC4_MOUSE Neurogenic locus notch homolog protein 4 OS=Mus musculus OX=10090 GN=Notch4 PE=1 SV=3
18	Q01705	0.15	38.9	2531	0.022	0.011	NOTC1_MOUSE Neurogenic locus notch homolog protein 1 OS=Mus musculus OX=10090 GN=Notch1 PE=1 SV=3
19	Q07008	0.15	38.9	2531	0.022	0.011	NOTC1_RAT Neurogenic locus notch homolog protein 1 OS=Rattus norvegicus OX=10116 GN=Notch1 PE=1 SV=3
20	Q61982	0.17	38.9	2318	0.028	0.015	NOTC3_MOUSE Neurogenic locus notch homolog protein 3 OS=Mus musculus OX=10090 GN=Notch3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06464 DMAP_binding	1.9e-23	94.8	DMAP1-binding Domain
2	PF00036 EF-hand_1	83	14.1	EF hand
3	PF13202 EF-hand_5	1.1e+02	13.7	EF hand
4	PF13499 EF-hand_7	1.1e+02	14.7	EF-hand domain pair
5	PF18440 GlcNAc-1_reg	1.5e-37	139.0	Putative GlcNAc-1 phosphotransferase regulatory domain
6	PF00066 Notch	1.9e-12	58.7	LNR domain
7	PF17101 Stealth_CR1	3.3e-08	44.4	Stealth protein CR1, conserved region 1
8	PF11380 Stealth_CR2	1.2e-41	152.6	Stealth protein CR2, conserved region 2
9	PF17102 Stealth_CR3	2.1e-14	64.5	Stealth protein CR3, conserved region 3
10	PF17103 Stealth_CR4	1.2e-20	84.5	Stealth protein CR4, conserved region 4

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000299314

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000204679	0.997	N-acetylglucosamine-1-phosphotransferase subunit gamma
2	9606.ENSP00000310998	0.936	N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase
3	9606.ENSP00000294785	0.906	Nicastrin
4	9606.ENSP00000256637	0.905	Sortilin
5	9606.ENSP00000261879	0.900	Gamma-secretase subunit APH-1B
6	9606.ENSP00000326366	0.900	Presenilin-1
7	9606.ENSP00000358105	0.900	Gamma-secretase subunit APH-1A
8	9606.ENSP00000396843	0.900	Nuclear factor 1 C-type
9	9606.ENSP00000433623	0.900	TNF receptor-associated factor 6
10	9606.ENSP00000468411	0.900	Gamma-secretase subunit PEN-2
11	9606.ENSP00000478533	0.900	Neurotrophin receptor-interacting factor homolog
12	9606.ENSP00000332706	0.805	Transcriptional activator protein Pur-alpha
13	9606.ENSP00000286621	0.800	Adenosine kinase
14	9606.ENSP00000327070	0.800	Malate dehydrogenase, mitochondrial
15	9606.ENSP00000332915	0.732	PCNA-interacting partner
16	9606.ENSP00000372088	0.681	DNA repair protein RAD51 homolog 1
17	9606.ENSP00000264380	0.678	1-phosphatidylinositol 3-phosphate 5-kinase
18	9606.ENSP00000386597	0.643	UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase
19	9606.ENSP00000395474	0.642	Sorting nexin-10
20	9606.ENSP00000395473	0.633	Lysosomal alpha-mannosidase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003976	1.000	UDP-N-acetylglucosamine-lysosomal-enzyme N-acetylglucosaminephosphotransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0044238	0.993	primary metabolic process
GO:0071704	0.992	organic substance metabolic process
GO:0044237	0.979	cellular metabolic process
GO:0006807	0.976	nitrogen compound metabolic process
GO:0016043	0.957	cellular component organization
GO:1901564	0.936	organonitrogen compound metabolic process
GO:0051179	0.931	localization
GO:0043170	0.929	macromolecule metabolic process
GO:0051234	0.923	establishment of localization
GO:0051641	0.917	cellular localization
GO:0019538	0.913	protein metabolic process
GO:0033036	0.906	macromolecule localization
GO:0005975	0.902	carbohydrate metabolic process
GO:0006810	0.900	transport
GO:0006996	0.887	organelle organization
GO:0008104	0.881	protein localization
GO:0071702	0.878	organic substance transport
GO:0015031	0.859	protein transport
GO:0051649	0.840	establishment of localization in cell
GO:0007041	0.832	lysosomal transport
GO:1901135	0.831	carbohydrate derivative metabolic process
GO:0009100	0.822	glycoprotein metabolic process
GO:0007033	0.813	vacuole organization
GO:0080171	0.793	lytic vacuole organization
GO:0006491	0.681	N-glycan processing
GO:0072665	0.626	protein localization to vacuole
GO:0006623	0.610	protein targeting to vacuole
GO:0061462	0.607	protein localization to lysosome
GO:0007040	0.591	lysosome organization
GO:0044262	0.555	cellular carbohydrate metabolic process
GO:0016310	0.536	phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098588	1.000	bounding membrane of organelle
GO:0005794	1.000	Golgi apparatus
GO:1902494	0.997	catalytic complex
GO:0000323	0.995	lytic vacuole
GO:0000139	0.994	Golgi membrane
GO:0005764	0.993	lysosome
GO:1990234	0.992	transferase complex
GO:0061695	0.982	transferase complex, transferring phosphorus-containing groups
GO:0031982	0.820	vesicle
GO:0070622	0.715	UDP-N-acetylglucosamine-lysosomal-enzyme N-acetylglucosaminephosphotransferase complex
GO:0070013	0.386	intracellular organelle lumen
GO:0043232	0.303	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:13581	1.000	N(4)-[alpha-D-mannosyl-(1->2)-alpha-D-mannosyl-(glycan)]-L-asparaginyl-[protein] + UDP-N-acetyl-alpha-D-glucosamine = H(+) + N(4)-[6-(N-acetyl-alpha-D-glucosaminyl-1-phospho)-alpha-D-mannosyl-(1->2)-alpha-D-mannosyl-(glycan)]-L-asparaginyl-[protein] + UMP
EC:2.7.8.17	1.000	N-acetylglucosaminephosphotransferase.

[back to server]