StarFunc result for job id Q3V6T2

User Input

>input (1871 residues)
MENEIFTPLLEQFMTSPLVTWVKTFGPLAAGNGTNLDEYVALVDGVFLNQVMLQINPKLE
SQRVNKKVNNDASLRMHNLSILVRQIKFYYQETLQQLIMMSLPNVLIIGKNPFSEQGTEE
VKKLLLLLLGCAVQCQKKEEFIERIQGLDFDTKAAVAAHIQEVTHNQENVFDLQWMEVTD
MSQEDIEPLLKNMALHLKRLIDERDEHSETIIELSEERDGLHFLPHASSSAQSPCGSPGM
KRTESRQHLSVELADAKAKIRRLRQELEEKTEQLLDCKQELEQMEIELKRLQQENMNLLS
DARSARMYRDELDALREKAVRVDKLESEVSRYKERLHDIEFYKARVEELKEDNQVLLETK
TMLEDQLEGTRARSDKLHELEKENLQLKAKLHDMEMERDMDRKKIEELMEENMTLEMAQK
QSMDESLHLGWELEQISRTSELSEAPQKSLGHEVNELTSSRLLKLEMENQSLTKTVEELR
TTVDSVEGNASKILKMEKENQRLSKKVEILENEIVQEKQSLQNCQNLSKDLMKEKAQLEK
TIETLRENSERQIKILEQENEHLNQTVSSLRQRSQISAEARVKDIEKENKILHESIKETS
SKLSKIEFEKRQIKKELEHYKEKGERAEELENELHHLEKENELLQKKITNLKITCEKIEA
LEQENSELERENRKLKKTLDSFKNLTFQLESLEKENSQLDEENLELRRNVESLKCASMKM
AQLQLENKELESEKEQLKKGLELLKASFKKTERLEVSYQGLDIENQRLQKTLENSNKKIQ
QLESELQDLEMENQTLQKNLEELKISSKRLEQLEKENKSLEQETSQLEKDKKQLEKENKR
LRQQAEIKDTTLEENNVKIGNLEKENKTLSKEIGIYKESCVRLKELEKENKELVKRATID
IKTLVTLREDLVSEKLKTQQMNNDLEKLTHELEKIGLNKERLLHDEQSTDDSRYKLLESK
LESTLKKSLEIKEEKIAALEARLEESTNYNQQLRQELKTVKKNYEALKQRQDEERMVQSS
PPISGEDNKWERESQETTRELLKVKDRLIEVERNNATLQAEKQALKTQLKQLETQNNNLQ
AQILALQRQTVSLQEQNTTLQTQNAKLQVENSTLNSQSTSLMNQNAQLLIQQSSLENENE
SVIKEREDLKSLYDSLIKDHEKLELLHERQASEYESLISKHGTLKSAHKNLEVEHRDLED
RYNQLLKQKGQLEDLEKMLKVEQEKMLLENKNHETVAAEYKKLCGENDRLNHTYSQLLKE
TEVLQTDHKNLKSLLNNSKLEQTRLEAEFSKLKEQYQQLDITSTKLNNQCELLSQLKGNL
EEENRHLLDQIQTLMLQNRTLLEQNMESKDLFHVEQRQYIDKLNELRRQKEKLEEKIMDQ
YKFYDPSPPRRRGNWITLKMRKLIKSKKDINRERQKSLTLTPTRSDSSEGFLQLPHQDSQ
DSSSVGSNSLEDGQTLGTKKSSMVALKRLPFLRNRPKDKDKMKACYRRSMSMNDLVQSMV
LAGQWTGSTENLEVPDDISTGKRRKELGAMAFSTTAINFSTVNSSAGFRSKQLVNNKDTT
SFEDISPQGVSDDSSTGSRVHASRPASLDSGRTSTSNSNNNASLHEVKAGAVNNQSRPQS
HSSGEFSLLHDHEAWSSSGSSPIQYLKRQTRSSPVLQHKISETLESRHHKIKTGSPGSEV
VTLQQFLEESNKLTSVQIKSSSQENLLDEVMKSLSVSSDFLGKDKPVSCGLARSVSGKTP
GDFYDRRTTKPEFLRPGPRKTEDTYFISSAGKPTPGTQGKIKLVKESSLSRQSKDSNPYA
TLPRASSVISTAEGTTRRTSIHDFLTKDSRLPISVDSPPAAADSNTTAASNVDKVQESRN
SKSRSREQQSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5SNZ0	0.290	0.290	0.000	1873	0.949	0.948	Q5SNZ0.pdb.gz	GRDN_MOUSE Girdin OS=Mus musculus OX=10090 GN=Ccdc88a PE=1 SV=2
2	AFDB:Q9P219	0.183	0.171	1.603E-103	2028	0.475	0.438	Q9P219.pdb.gz	DAPLE_HUMAN Protein Daple OS=Homo sapiens OX=9606 GN=CCDC88C PE=1 SV=3
3	AFDB:Q6VGS5	0.279	0.262	6.042E-98	2009	0.462	0.430	Q6VGS5.pdb.gz	DAPLE_MOUSE Protein Daple OS=Mus musculus OX=10090 GN=Ccdc88c PE=1 SV=1
4	AFDB:P85120	0.185	0.169	2.690E-96	2058	0.465	0.423	P85120.pdb.gz	DAPLE_XENLA Protein Daple OS=Xenopus laevis OX=8355 GN=ccdc88c PE=1 SV=1
5	AFDB:A0A2R8QCI3	0.209	0.197	4.091E-94	2023	0.476	0.440	A0A2R8QCI3.pdb.gz	DAPLE_DANRE Protein Daple OS=Danio rerio OX=7955 GN=ccdc88c PE=2 SV=1
6	AFDB:Q9VZT7	0.110	0.143	6.458E-38	1381	0.220	0.298	Q9VZT7.pdb.gz	Q9VZT7_DROME Girdin, isoform A OS=Drosophila melanogaster OX=7227 GN=Girdin PE=1 SV=1
7	AFDB:F3Y5P4	0.090	0.123	3.092E-21	1319	0.170	0.241	F3Y5P4.pdb.gz	GRDN_CAEEL Girdin homolog OS=Caenorhabditis elegans OX=6239 GN=grdn-1 PE=1 SV=1
8	AFDB:Q14980	0.068	0.061	1.478E-12	2115	0.191	0.169	Q14980.pdb.gz	NUMA1_HUMAN Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1 PE=1 SV=2
9	AFDB:F6ZDS4	0.056	0.044	3.229E-12	2431	0.166	0.128	F6ZDS4.pdb.gz	TPR_MOUSE Nucleoprotein TPR OS=Mus musculus OX=10090 GN=Tpr PE=1 SV=1
10	AFDB:A1Z8P9	0.057	0.047	9.861E-12	2346	0.174	0.139	A1Z8P9.pdb.gz	TPR_DROME Nucleoprotein TPR OS=Drosophila melanogaster OX=7227 GN=Mtor PE=1 SV=1
11	PDB:7v2wF	0.045	0.108	1.019E-1	593	0.019	0.059	7v2wF.pdb.gz
12	PDB:6ikoA	0.031	0.124	4.863E-1	303	0.020	0.125	6ikoA.pdb.gz
13	PDB:3jcfA	0.026	0.113	5.437E-1	349	0.009	0.046	3jcfA.pdb.gz
14	PDB:7mqaLQ	0.033	0.058	6.798E-1	830	0.015	0.034	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:6exnO	0.030	0.118	8.498E-1	320	0.030	0.178	6exnO.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
16	PDB:6neqe	0.041	0.126	8.498E-1	358	0.013	0.067	6neqe.pdb.gz	Structure of Human Mitochondrial Translation Initiation Factor 3 Bound to the Small Ribosomal Subunit.
17	PDB:7ohrI	0.041	0.147	8.498E-1	409	0.017	0.078	7ohrI.pdb.gz	Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
18	PDB:7eebB	0.028	0.133	1.005	281	0.017	0.110	7eebB.pdb.gz	Structure of a mammalian sperm cation channel complex.
19	PDB:7zu0E	0.033	0.127	1.123	343	0.022	0.122	7zu0E.pdb.gz
20	PDB:2ilkA	0.030	0.155	1.188	155	0.011	0.129	2ilkA.pdb.gz	Crystal structure of human interleukin-10 at 1.6 A resolution and a model of a complex with its soluble receptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8QCI3	0.0	1443	2023	0.478	0.442	DAPLE_DANRE Protein Daple OS=Danio rerio OX=7955 GN=ccdc88c PE=2 SV=1
2	A0A8I5ZW24	0.0	3458	1845	0.933	0.946	A0A8I5ZW24_RAT Coiled coil domain containing 88A OS=Rattus norvegicus OX=10116 GN=Ccdc88a PE=4 SV=1
3	A0A8I6A5W7	0.0	3533	1873	0.948	0.947	A0A8I6A5W7_RAT Coiled coil domain containing 88A OS=Rattus norvegicus OX=10116 GN=Ccdc88a PE=4 SV=1
4	D3ZYD7	0.0	2777	1523	0.755	0.928	D3ZYD7_RAT Coiled coil domain containing 88A OS=Rattus norvegicus OX=10116 GN=Ccdc88a PE=1 SV=4
5	P85120	0.0	1463	2058	0.458	0.416	DAPLE_XENLA Protein Daple OS=Xenopus laevis OX=8355 GN=ccdc88c PE=1 SV=1
6	Q3V6T2	0.0	3764	1871	1.000	1.000	GRDN_HUMAN Girdin OS=Homo sapiens OX=9606 GN=CCDC88A PE=1 SV=2
7	Q5SNZ0	0.0	3547	1873	0.950	0.949	GRDN_MOUSE Girdin OS=Mus musculus OX=10090 GN=Ccdc88a PE=1 SV=2
8	Q6VGS5	0.0	1472	2009	0.477	0.444	DAPLE_MOUSE Protein Daple OS=Mus musculus OX=10090 GN=Ccdc88c PE=1 SV=1
9	Q9P219	0.0	1521	2028	0.432	0.399	DAPLE_HUMAN Protein Daple OS=Homo sapiens OX=9606 GN=CCDC88C PE=1 SV=3
10	Q9VZT7	7.52e-74	275	1381	0.136	0.184	Q9VZT7_DROME Girdin, isoform A OS=Drosophila melanogaster OX=7227 GN=Girdin PE=1 SV=1
11	M9PDY5	7.62e-74	275	1380	0.136	0.184	M9PDY5_DROME Girdin, isoform C OS=Drosophila melanogaster OX=7227 GN=Girdin PE=1 SV=1
12	M9PE55	1.19e-73	274	1346	0.136	0.189	M9PE55_DROME Girdin, isoform E OS=Drosophila melanogaster OX=7227 GN=Girdin PE=1 SV=1
13	M9PEG0	2.42e-73	272	1236	0.136	0.206	M9PEG0_DROME Girdin, isoform D OS=Drosophila melanogaster OX=7227 GN=Girdin PE=1 SV=1
14	Q8SX64	2.55e-73	272	1235	0.136	0.206	Q8SX64_DROME Girdin, isoform B OS=Drosophila melanogaster OX=7227 GN=Girdin PE=1 SV=1
15	Q4QRL3	6.01e-68	256	1481	0.111	0.140	CC88B_MOUSE Coiled-coil domain-containing protein 88B OS=Mus musculus OX=10090 GN=Ccdc88b PE=1 SV=2
16	A6NC98	8.90e-65	246	1476	0.102	0.129	CC88B_HUMAN Coiled-coil domain-containing protein 88B OS=Homo sapiens OX=9606 GN=CCDC88B PE=1 SV=1
17	Q8BUK6	7.79e-22	105	718	0.058	0.150	HOOK3_MOUSE Protein Hook homolog 3 OS=Mus musculus OX=10090 GN=Hook3 PE=1 SV=2
18	Q86VS8	1.65e-21	104	718	0.057	0.148	HOOK3_HUMAN Protein Hook homolog 3 OS=Homo sapiens OX=9606 GN=HOOK3 PE=1 SV=2
19	Q96ED9	6.38e-16	86.3	719	0.072	0.186	HOOK2_HUMAN Protein Hook homolog 2 OS=Homo sapiens OX=9606 GN=HOOK2 PE=1 SV=3
20	F3Y5P4	9.79e-16	86.3	1319	0.055	0.078	GRDN_CAEEL Girdin homolog OS=Caenorhabditis elegans OX=6239 GN=grdn-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17675 APG6_N	0.77	21.7	Apg6 coiled-coil region
2	PF19047 HOOK_N	1.4e-17	75.2	HOOK domain
3	PF14662 KASH_CCD	11	17.4	Coiled-coil region of CCDC155 or KASH

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000338728

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355593	0.987	Disrupted in schizophrenia 1 protein
2	9606.ENSP00000451828	0.985	RAC-alpha serine/threonine-protein kinase
3	9606.ENSP00000275493	0.912	Epidermal growth factor receptor
4	9606.ENSP00000358867	0.864	Guanine nucleotide-binding protein G(k) subunit alpha
5	9606.ENSP00000333982	0.702	Nuclear distribution protein nudE-like 1
6	9606.ENSP00000311825	0.656	C-terminal-binding protein 2
7	9606.ENSP00000372576	0.625	Coiled-coil domain containing 178
8	9606.ENSP00000363921	0.612	Partitioning defective 3 homolog
9	9606.ENSP00000005340	0.602	Segment polarity protein dishevelled homolog DVL-2
10	9606.ENSP00000394352	0.577	Dixin
11	9606.ENSP00000424765	0.577	Angiomotin-like protein 2
12	9606.ENSP00000477213	0.563	Amyloid-beta A4 precursor protein-binding family B member 1
13	9606.ENSP00000432172	0.552	Coiled-coil domain containing 17
14	9606.ENSP00000275364	0.550	Guanine nucleotide-binding protein subunit alpha-12
15	9606.ENSP00000400717	0.549	Guanine nucleotide-binding protein subunit alpha-13
16	9606.ENSP00000380378	0.521	Platelet-activating factor acetylhydrolase IB subunit alpha
17	9606.ENSP00000278780	0.505	Transcription factor Ovo-like 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0098772	0.506	molecular function regulator activity
GO:0019899	0.432	enzyme binding
GO:0042802	0.413	identical protein binding
GO:0043422	0.357	protein kinase B binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0048522	0.994	positive regulation of cellular process
GO:0009987	0.993	cellular process
GO:0019222	0.976	regulation of metabolic process
GO:0031323	0.971	regulation of cellular metabolic process
GO:0051716	0.968	cellular response to stimulus
GO:0007165	0.957	signal transduction
GO:0035556	0.949	intracellular signal transduction
GO:0044093	0.942	positive regulation of molecular function
GO:0043549	0.936	regulation of kinase activity
GO:0031325	0.932	positive regulation of cellular metabolic process
GO:0051173	0.930	positive regulation of nitrogen compound metabolic process
GO:0045859	0.928	regulation of protein kinase activity
GO:0051347	0.925	positive regulation of transferase activity
GO:0045860	0.921	positive regulation of protein kinase activity
GO:0051128	0.821	regulation of cellular component organization
GO:0032147	0.794	activation of protein kinase activity
GO:0009966	0.639	regulation of signal transduction
GO:0071840	0.534	cellular component organization or biogenesis
GO:0031344	0.530	regulation of cell projection organization
GO:0120035	0.510	regulation of plasma membrane bounded cell projection organization
GO:0016043	0.489	cellular component organization
GO:0042127	0.373	regulation of cell population proliferation
GO:0019219	0.347	regulation of nucleobase-containing compound metabolic process
GO:0051179	0.320	localization
GO:0048519	0.310	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0031982	0.995	vesicle
GO:0012505	0.991	endomembrane system
GO:0005829	0.963	cytosol
GO:0031410	0.883	cytoplasmic vesicle
GO:0016020	0.874	membrane
GO:0071944	0.869	cell periphery
GO:0043232	0.748	intracellular non-membrane-bounded organelle
GO:0005798	0.731	Golgi-associated vesicle
GO:0030135	0.728	coated vesicle
GO:0030133	0.674	transport vesicle
GO:0030137	0.634	COPI-coated vesicle
GO:0005856	0.593	cytoskeleton
GO:0005886	0.583	plasma membrane
GO:0031252	0.567	cell leading edge
GO:0015630	0.526	microtubule cytoskeleton
GO:0070013	0.320	intracellular organelle lumen
GO:0005654	0.308	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]