StarFunc result for job id Q3ZCN5

User Input

>input (2332 residues)
MIPWSIFLLHVLLFSLQEYICASSILMGTSKNGFNENRQKRALLAAQFEATSPRYFFHDA
INWGESKIKGSCPYECLNGAFCSKTGTCDCQIFQALGTRCQIIPNMGNGRDGICKTWGQY
HFETFDGIYYYFPGNCSYIFAKDCGDLEPRYTVWVHNSPKCLGSVYSCYRSISLFFSNQE
EIRIYGHEIKKNGISLTLPQTIGQIFIEKLADYILVKTTFGFSLAWDGISGIYLKLSEDH
KGKSCGLCGNYNDIQSDDFIILQEDYTEDIAMFANSWSVQTPDDTKCVLTPSDFPNPCSS
GMPAFEAIFFKCQILLQFPFLSCHEYIDPYLYIASCVNDLCKTDDDETYCRAATEYARAC
SHAGYPIQDWRDDFPACTDKCDDSFVHRDCISCCPPTCTFEKQCLGSNLHCLDGCYCPDG
LVMDNGTCISLENCPCGFHGLAYSVGSKIEQECTECVCVGGVWNCTEQDCPVQCSVVGDS
HFTTFDGRHYSFIGMCQYILVKGTGKDKFTITLQKAPCEQNLGLVCLQSITLILEDDFNK
QVTLGRGGQILTSPNQGFNLNGIVEIQTLSSLFILLKTTFGLKILFAIDGERIYIQLTSA
WKRRTLGLCGTFNGNIRDDFLSPSGMIEGTPQLHANAWRVSSTCFAPVHVPVVDPCNINQ
QNIGYAAHCDVIHQELFAPCHIYISPGLYYQLCRHDACKCGSSCLCNALAHYAYLCGQHG
VPIDFRTQISFCAVVCQKGMLYHHCSSFCLHSCISLSSPEQCSDDCAEGCNCPEGKFYED
TLNFCVPIFHCRCHYRGSVYQPGELIPTPSGLCQCSNGTVKCDELATPSAVHICPEGKEY
FDCRFPDPELPAGGVNCETTCANLAMNFTCTPSSPCISGCVCAPGMAEHRGKCYVPESCP
CIWKDWEYLSGEVIATPCYTCVCRRGMFNCTYYPCPAVCTIYGDRHYYSFDGLEYDYISD
CQVFLIKSADDSDISVIAQNKKCFDNDIVCSKSVLISVGDTEIYLNDTPYKQKQSGFFLE
NKSTYQLWKAGYYIVVYFPEKDITILWDRKTTIHIKVGPQWKNKLSGLCGNFDKCTSNDM
TTSNNLEVRNARVFGDSWALGQCESPDETIKPCEAHQNKFPYAKKECSILYSDIFASCRN
VIDVTSFAKNCHEDTCNCNLGGDCECLCTSIAAYAYKCCQEGISIHWRSSTVCSLDCEYY
NEGLGEGPYMLASYGQSGLVLGANMTSRSVFCLPRSSVHTSLFFYFMITPGLFKEKVSSL
ALVSLESAERPNYFLYVHDNDTLSLELWEANSAFHRRATFFHHQGLWIPGYSAFELYSKK
GFFIIFTDSSVKASKYDDSEEFKHSSSFSIEEIQAAVPYRKMCEWRYEPCATPCFKTCSD
PEALACKFLPPVEGCLPYCPKNMILDEVTLKCVYPRDCIPVIPTEPTLMPPAKPTVPITV
FDMLTPTTGLECEPQKFDPVYDCSQYICLNMEWQLYNWSLNCPKDVEMPDCGFRGRPVQV
NSDICCPEWECPCRCSMLSELSIITFDGNNAALYSMASYILVRIPGEIIVAHIEKCSMNQ
NGNSLKKLAPSGRISGLCFKKLNVTTPIHKIIVNRLARKVEVDSIVVPLPFSSQELSIED
SGSMYVITTPAGLIIKWSHLTGIIDIHFGFRFNLSSYTEGLCGICNEDPDDDLRMQNGTI
ITNMEDIGLFIESWEIEKSFEVTMRRPVRNCTEHDCSQCIDLLNRRIFIPCHDKVSPEDF
CEKMWINYTYFWNYECDALSAYVALCNKFDICIQWRTPDYCSLSCPEGKEYQPCVRPCEA
RTCLNQWFYGHTSCLNLREDCVCKVGTILHRPHSAQCIPEKECACTDSEDQPRTAGEIWN
GGIDECTLYKCLENGSIIPIEPDCDEEPTPVCEREAEVVMGIIDKWTCCSKEVCGCDTTL
CETSIPTCTNSQKLIVGHSPLSCCPQYKCECDPLKCPSISTPECREDQFMIQVRQEEPCC
FSPFCVCESCTKPVPLCHDGEFLTVDLNSTHFCCPQYYCVCEPNLCPMPLLNCAEDMNLV
KENVSGQCCPTWHCECNCENLIMPTCEVGEFTAIDHNFQSDCGCIQYLCEKDDVCVFQEV
SVLNPGQSMIKYLEEDFCYAIECLEEKDNHTGFHTLNFTLVNCSKKCDVHQVYTPSPSDY
GCCGTCKNVSCKFHMENGTSVVYAVGSTWHYNCTTYECVKTDEGAIILNYTMVCPPFNET
ECKMNEGIVKLYNEGCCKICKREERICQKVIIKSVIRKQDCMSQSPINVASCDGKCPSAT
IYNINIESHLRFCKCCRENGVRNLSVPLYCSGNGTEIMYTLQEPIDCTCQWN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A286YAF1	0.351	0.374	0.000	2146	0.505	0.548	A0A286YAF1.pdb.gz
2	AFDB:Q3ZCN5	1.000	1.000	0.000	2332	1.000	1.000	Q3ZCN5.pdb.gz	OTOGL_HUMAN Otogelin-like protein OS=Homo sapiens OX=9606 GN=OTOGL PE=1 SV=6
3	AFDB:Q98UI9	0.257	0.282	0.000	2108	0.228	0.252	Q98UI9.pdb.gz	MUC5B_CHICK Mucin-5B OS=Gallus gallus OX=9031 GN=MUC5B PE=1 SV=1
4	AFDB:A0A0G2K1Y4	0.257	0.509	3.922E-86	1103	0.150	0.317	A0A0G2K1Y4.pdb.gz	A0A0G2K1Y4_RAT Mucin 5AC, oligomeric mucus/gel-forming OS=Rattus norvegicus OX=10116 GN=Muc5ac PE=4 SV=2
5	AFDB:Q28983	0.148	0.141	5.757E-82	2476	0.164	0.154	Q28983.pdb.gz	ZAN_PIG Zonadhesin OS=Sus scrofa OX=9823 GN=ZAN PE=1 SV=1
6	AFDB:Q6W4X9	0.264	0.253	2.116E-81	2439	0.157	0.150	Q6W4X9.pdb.gz	MUC6_HUMAN Mucin-6 OS=Homo sapiens OX=9606 GN=MUC6 PE=1 SV=3
7	AFDB:F1NBL0	0.253	0.472	1.039E-80	1185	0.141	0.278	F1NBL0.pdb.gz	MUC6_CHICK Mucin-6 (Fragment) OS=Gallus gallus OX=9031 GN=MUC6 PE=1 SV=1
8	AFDB:O08523	0.131	0.141	5.539E-77	2155	0.178	0.193	O08523.pdb.gz	TECTA_MOUSE Alpha-tectorin OS=Mus musculus OX=10090 GN=Tecta PE=1 SV=2
9	AFDB:E9Q0B5	0.141	0.129	1.600E-76	2583	0.169	0.153	E9Q0B5.pdb.gz	E9Q0B5_MOUSE Fc fragment of IgG binding protein OS=Mus musculus OX=10090 GN=Fcgbp PE=1 SV=1
10	AFDB:F1QK57	0.146	0.152	1.194E-68	2201	0.168	0.178	F1QK57.pdb.gz
11	PDB:2d43A	0.055	0.246	1.276E-4	482	0.024	0.118	2d43A.pdb.gz	The family 42 carbohydrate-binding module of family 54 alpha-L-arabinofuranosidase specifically binds the arabinofuranose side chain of hemicellulose
12	PDB:6z3mc	0.050	0.519	3.511E-4	158	0.009	0.139	6z3mc.pdb.gz	Repulsive guidance molecules lock growth differentiation factor 5 in an inhibitory complex.
13	PDB:5bowA	0.048	0.576	5.164E-4	151	0.008	0.126	5bowA.pdb.gz
14	PDB:1md6A	0.050	0.592	5.687E-4	154	0.009	0.143	1md6A.pdb.gz
15	PDB:4izeA	0.053	0.610	9.210E-4	152	0.009	0.132	4izeA.pdb.gz
16	PDB:6b0tA	0.053	0.232	1.291E-3	487	0.016	0.076	6b0tA.pdb.gz	Structural Insights into the Induced-fit Inhibition of Fascin by a Small-Molecule Inhibitor.
17	PDB:4qd2B	0.053	0.713	1.724E-3	143	0.010	0.168	4qd2B.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.
18	PDB:4qd2C	0.056	0.415	2.415E-3	286	0.015	0.119	4qd2C.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.
19	PDB:6hpiA	0.050	0.547	2.660E-3	158	0.009	0.133	6hpiA.pdb.gz
20	PDB:6xt9A	0.038	0.083	4.308E-3	567	0.027	0.109	6xt9A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O55225	0.0	1207	2911	0.253	0.202	OTOG_MOUSE Otogelin OS=Mus musculus OX=10090 GN=Otog PE=1 SV=3
2	Q3ZCN5	0.0	4800	2353	1.000	0.991	OTOGL_HUMAN Otogelin-like protein OS=Homo sapiens OX=9606 GN=OTOGL PE=1 SV=6
3	E7F9Z1	2.52e-174	599	2812	0.154	0.128	E7F9Z1_DANRE von Willebrand factor OS=Danio rerio OX=7955 GN=VWF PE=1 SV=3
4	Q8CIZ8	1.47e-170	588	2813	0.158	0.131	VWF_MOUSE von Willebrand factor OS=Mus musculus OX=10090 GN=Vwf PE=1 SV=2
5	P98088	9.46e-170	587	5654	0.160	0.066	MUC5A_HUMAN Mucin-5AC OS=Homo sapiens OX=9606 GN=MUC5AC PE=1 SV=4
6	P04275	6.23e-163	565	2813	0.159	0.132	VWF_HUMAN von Willebrand factor OS=Homo sapiens OX=9606 GN=VWF PE=1 SV=4
7	Q62635	1.64e-162	546	1513	0.153	0.235	MUC2_RAT Mucin-2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Muc2 PE=1 SV=1
8	E9QAQ8	1.96e-161	561	3455	0.153	0.103	E9QAQ8_MOUSE Mucin 5, subtypes A and C, tracheobronchial/gastric OS=Mus musculus OX=10090 GN=Muc5ac PE=1 SV=5
9	Q80Z19	2.27e-159	553	2680	0.154	0.134	MUC2_MOUSE Mucin-2 OS=Mus musculus OX=10090 GN=Muc2 PE=1 SV=3
10	Q9ESP3	2.74e-159	544	1851	0.154	0.193	Q9ESP3_RAT Mucin (Fragment) OS=Rattus norvegicus OX=10116 GN=Muc5ac PE=2 SV=1
11	E9PWB6	3.05e-159	553	2751	0.153	0.129	E9PWB6_MOUSE Mucin 5, subtypes A and C, tracheobronchial/gastric OS=Mus musculus OX=10090 GN=Muc5ac PE=1 SV=1
12	Q02817	1.21e-156	546	5179	0.151	0.068	MUC2_HUMAN Mucin-2 OS=Homo sapiens OX=9606 GN=MUC2 PE=1 SV=3
13	Q8BYW0	2.92e-156	527	1477	0.150	0.236	Q8BYW0_MOUSE VWFD domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Muc5b PE=2 SV=1
14	A0A0G2K1Y4	5.39e-156	544	3586	0.153	0.099	A0A0G2K1Y4_RAT Mucin 5AC, oligomeric mucus/gel-forming OS=Rattus norvegicus OX=10116 GN=Muc5ac PE=4 SV=2
15	A0A0G2K8X5	6.49e-156	544	3922	0.153	0.091	A0A0G2K8X5_RAT Mucin 5AC, oligomeric mucus/gel-forming OS=Rattus norvegicus OX=10116 GN=Muc5ac PE=4 SV=2
16	Q9HC84	1.22e-150	528	5762	0.151	0.061	MUC5B_HUMAN Mucin-5B OS=Homo sapiens OX=9606 GN=MUC5B PE=1 SV=3
17	E9Q5I3	5.61e-150	525	4800	0.151	0.073	E9Q5I3_MOUSE Mucin 5, subtype B, tracheobronchial OS=Mus musculus OX=10090 GN=Muc5b PE=1 SV=1
18	Q8K1G6	2.62e-149	523	4782	0.151	0.073	Q8K1G6_MOUSE Muc5b protein OS=Mus musculus OX=10090 GN=Muc5b PE=2 SV=1
19	Q98UI9	1.62e-147	512	2108	0.148	0.164	MUC5B_CHICK Mucin-5B OS=Gallus gallus OX=9031 GN=MUC5B PE=1 SV=1
20	F1NBL0	2.02e-145	488	1185	0.150	0.295	MUC6_CHICK Mucin-6 (Fragment) OS=Gallus gallus OX=9031 GN=MUC6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05270 AbfB	0.0015	30.0	Alpha-L-arabinofuranosidase B (ABFB) domain
2	PF08742 C8	8.1e-43	155.9	C8 domain
3	PF01826 TIL	8.9e-11	53.1	Trypsin Inhibitor like cysteine rich domain
4	PF00094 VWD	3.9e-94	324.6	von Willebrand factor type D domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000400895

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000373610	0.777	Otoancorin
2	9606.ENSP00000401513	0.747	Stereocilin
3	9606.ENSP00000296358	0.700	Otopetrin-1
4	9606.ENSP00000358430	0.666	Beta-tectorin
5	9606.ENSP00000220853	0.656	ER membrane protein complex subunit 2
6	9606.ENSP00000466561	0.647	Carcinoembryonic antigen-related cell adhesion molecule 16
7	9606.ENSP00000330808	0.639	Otolin-1
8	9606.ENSP00000237172	0.636	Filamin-A-interacting protein 1
9	9606.ENSP00000245312	0.626	Ileal sodium/bile acid cotransporter
10	9606.ENSP00000368468	0.626	Mitochondrial calcium uniporter regulator 1
11	9606.ENSP00000481358	0.606	Transmembrane protein 191B
12	9606.ENSP00000334068	0.600	Olfactory receptor 13C8
13	9606.ENSP00000358994	0.597	Unconventional myosin-VI
14	9606.ENSP00000359579	0.586	Heparan sulfate 2-O-sulfotransferase 1
15	9606.ENSP00000273353	0.584	Myosin-15
16	9606.ENSP00000359581	0.558	Heparan sulfate 2-O-sulfotransferase 1
17	9606.ENSP00000274643	0.551	Myosin light chain kinase family member 4
18	9606.ENSP00000261892	0.543	Sodium/potassium/calcium exchanger 1
19	9606.ENSP00000261172	0.541	Epiphycan
20	9606.ENSP00000366715	0.527	Transmembrane protein 236

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.927	multicellular organismal process
GO:0009987	0.749	cellular process
GO:0003008	0.748	system process
GO:0050954	0.736	sensory perception of mechanical stimulus
GO:0007605	0.728	sensory perception of sound
GO:0032502	0.526	developmental process
GO:0065007	0.451	biological regulation
GO:0048856	0.364	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.997	cell periphery
GO:0005576	0.992	extracellular region
GO:0016020	0.954	membrane
GO:0005615	0.951	extracellular space
GO:0043226	0.836	organelle
GO:0005737	0.835	cytoplasm
GO:0005886	0.684	plasma membrane
GO:0031012	0.639	extracellular matrix
GO:0043227	0.620	membrane-bounded organelle
GO:0043229	0.548	intracellular organelle
GO:0012505	0.340	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]