StarFunc result for job id Q3ZCQ8

User Input

>input (353 residues)
MAASAAVFSRLRSGLRLGSRGLCTRLATPPRRAPDQAAEIGSRGSTKAQGPQQQPGSEGP
SYAKKVALWLAGLLGAGGTVSVVYIFGNNPVDENGAKIPDEFDNDPILVQQLRRTYKYFK
DYRQMIIEPTSPCLLPDPLQEPYYQPPYTLVLELTGVLLHPEWSLATGWRFKKRPGIETL
FQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMDGHHVKDISCLNRD
PARVVVVDCKKEAFRLQPYNGVALRPWDGNSDDRVLLDLSAFLKTIALNGVEDVRTVLEH
YALEDDPLAAFKQRQSRLEQEEQQRLAELSKSNKQNLFLGSLTSRLWPRSKQP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R0M6	0.815	0.634	1.375E-62	456	1.000	0.774	A0A024R0M6.pdb.gz
2	AFDB:Q6NWD4	0.799	0.731	3.162E-49	387	0.649	0.592	Q6NWD4.pdb.gz	TIM50_DANRE Mitochondrial import inner membrane translocase subunit TIM50 OS=Danio rerio OX=7955 GN=timm50 PE=2 SV=2
3	AFDB:Q9W4V8	0.651	0.542	1.049E-35	428	0.422	0.348	Q9W4V8.pdb.gz	TI50C_DROME Mitochondrial import inner membrane translocase subunit TIM50-C OS=Drosophila melanogaster OX=7227 GN=ttm50 PE=2 SV=2
4	AFDB:M0R2Q2	0.434	0.764	1.722E-31	200	0.482	0.850	M0R2Q2.pdb.gz	M0R2Q2_HUMAN Mitochondrial import inner membrane translocase subunit TIM50 (Fragment) OS=Homo sapiens OX=9606 GN=TIMM50 PE=1 SV=2
5	AFDB:O13636	0.582	0.463	3.109E-25	452	0.297	0.232	O13636.pdb.gz	TIM50_SCHPO Mitochondrial import inner membrane translocase subunit tim50 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tim50 PE=3 SV=1
6	AFDB:Q59W44	0.589	0.452	1.718E-24	469	0.263	0.198	Q59W44.pdb.gz	TIM50_CANAL Mitochondrial import inner membrane translocase subunit TIM50 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TIM50 PE=3 SV=1
7	AFDB:Q02776	0.597	0.455	5.823E-24	476	0.269	0.200	Q02776.pdb.gz	TIM50_YEAST Mitochondrial import inner membrane translocase subunit TIM50 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIM50 PE=1 SV=1
8	AFDB:Q8VYE2	0.561	0.527	1.777E-22	376	0.272	0.255	Q8VYE2.pdb.gz	TIM50_ARATH Mitochondrial import inner membrane translocase subunit TIM50 OS=Arabidopsis thaliana OX=3702 GN=TIM50 PE=1 SV=1
9	AFDB:A0A024R5Q8	0.427	0.328	1.229E-15	466	0.178	0.135	A0A024R5Q8.pdb.gz
10	AFDB:F4KHG9	0.434	0.339	1.668E-15	456	0.170	0.132	F4KHG9.pdb.gz	F4KHG9_ARATH SCP1-like small phosphatase 4 OS=Arabidopsis thaliana OX=3702 GN=SSP4 PE=4 SV=1
11	PDB:2r8xH	0.281	0.492	6.596E-3	183	0.071	0.137	2r8xH.pdb.gz
12	PDB:3l8eA	0.286	0.501	7.452E-3	185	0.079	0.151	3l8eA.pdb.gz	Structural Determinants of Substrate Recognition in the HAD Superfamily Member d-glycero-d-manno-Heptose-1,7-bisphosphate Phosphatase (GmhB) .
13	PDB:5it0A	0.254	0.229	3.428E-2	396	0.082	0.073	5it0A.pdb.gz	SAD phasing using iodide ions in a high-throughput structural genomics environment.
14	PDB:5a07A	0.128	0.116	9.104E-2	395	0.051	0.046	5a07A.pdb.gz	Structure of the Glycosyltransferase Ktr4P from Saccharomyces Cerevisiae
15	PDB:7bssA	0.112	0.052	9.677E-2	816	0.051	0.022	7bssA.pdb.gz	Transport Cycle of Plasma Membrane Flippase ATP11C by Cryo-EM.
16	PDB:2ia5H	0.207	0.237	1.029E-1	301	0.082	0.096	2ia5H.pdb.gz	Structure-function analysis of the 3' phosphatase component of T4 polynucleotide kinase/phosphatase.
17	PDB:4zevA	0.140	0.167	1.093E-1	290	0.040	0.048	4zevA.pdb.gz	Cap-domain closure enables diverse substrate recognition by the C2-type haloacid dehalogenase-like sugar phosphatase Plasmodium falciparum HAD1.
18	PDB:4pqgA	0.236	0.178	1.313E-1	506	0.065	0.045	4pqgA.pdb.gz	Structure of a Novel O-Linked N-Acetyl-d-glucosamine (O-GlcNAc) Transferase, GtfA, Reveals Insights into the Glycosylation of Pneumococcal Serine-rich Repeat Adhesins.
19	PDB:5ue7A	0.150	0.204	1.313E-1	251	0.042	0.060	5ue7A.pdb.gz	Crystal structure of the phosphomannomutase PMM1 from Candida albicans, apoenzyme state
20	PDB:1b14A	0.107	0.140	1.577E-1	254	0.028	0.039	1b14A.pdb.gz	The catalytic reaction and inhibition mechanism of Drosophila alcohol dehydrogenase: observation of an enzyme-bound NAD-ketone adduct at 1.4 A resolution by X-ray crystallography.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	M0R003	0.0	514	257	0.725	0.996	M0R003_HUMAN Mitochondrial import inner membrane translocase subunit TIM50 (Fragment) OS=Homo sapiens OX=9606 GN=TIMM50 PE=1 SV=1
2	M0R1Y4	0.0	520	256	0.725	1.000	M0R1Y4_HUMAN Mitochondrial import inner membrane translocase subunit TIM50 (Fragment) OS=Homo sapiens OX=9606 GN=TIMM50 PE=1 SV=2
3	Q3ZCQ8	0.0	726	353	1.000	1.000	TIM50_HUMAN Mitochondrial import inner membrane translocase subunit TIM50 OS=Homo sapiens OX=9606 GN=TIMM50 PE=1 SV=2
4	Q9D880	0.0	677	353	0.918	0.918	TIM50_MOUSE Mitochondrial import inner membrane translocase subunit TIM50 OS=Mus musculus OX=10090 GN=Timm50 PE=1 SV=1
5	Q6NWD4	4.36e-168	475	387	0.618	0.563	TIM50_DANRE Mitochondrial import inner membrane translocase subunit TIM50 OS=Danio rerio OX=7955 GN=timm50 PE=2 SV=2
6	M0R047	6.47e-145	410	227	0.555	0.863	M0R047_HUMAN Mitochondrial import inner membrane translocase subunit TIM50 (Fragment) OS=Homo sapiens OX=9606 GN=TIMM50 PE=1 SV=1
7	M0R2Q2	1.02e-109	320	200	0.490	0.865	M0R2Q2_HUMAN Mitochondrial import inner membrane translocase subunit TIM50 (Fragment) OS=Homo sapiens OX=9606 GN=TIMM50 PE=1 SV=2
8	Q9W4V8	2.80e-84	263	428	0.371	0.306	TI50C_DROME Mitochondrial import inner membrane translocase subunit TIM50-C OS=Drosophila melanogaster OX=7227 GN=ttm50 PE=2 SV=2
9	O13636	1.89e-46	166	452	0.272	0.212	TIM50_SCHPO Mitochondrial import inner membrane translocase subunit tim50 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tim50 PE=3 SV=1
10	Q8VYE2	1.08e-39	146	376	0.201	0.189	TIM50_ARATH Mitochondrial import inner membrane translocase subunit TIM50 OS=Arabidopsis thaliana OX=3702 GN=TIM50 PE=1 SV=1
11	Q59W44	8.84e-38	142	469	0.193	0.145	TIM50_CANAL Mitochondrial import inner membrane translocase subunit TIM50 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TIM50 PE=3 SV=1
12	Q02776	2.72e-36	139	476	0.187	0.139	TIM50_YEAST Mitochondrial import inner membrane translocase subunit TIM50 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIM50 PE=1 SV=1
13	Q07949	2.20e-22	99.4	397	0.156	0.139	PSR2_YEAST Probable phosphatase PSR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PSR2 PE=1 SV=1
14	Q9LYI7	8.53e-22	96.3	305	0.164	0.190	Q9LYI7_ARATH At5g11860 OS=Arabidopsis thaliana OX=3702 GN=SSP5 PE=1 SV=1
15	F4JQR6	2.87e-18	87.8	446	0.167	0.132	F4JQR6_ARATH SCP1-like small phosphatase 4b OS=Arabidopsis thaliana OX=3702 GN=SSP4B PE=4 SV=1
16	H7C270	7.34e-18	84.0	254	0.144	0.201	H7C270_HUMAN protein-serine/threonine phosphatase (Fragment) OS=Homo sapiens OX=9606 GN=CTDSP1 PE=1 SV=1
17	F4KHG9	1.11e-17	85.9	456	0.144	0.112	F4KHG9_ARATH SCP1-like small phosphatase 4 OS=Arabidopsis thaliana OX=3702 GN=SSP4 PE=4 SV=1
18	Q5A7R0	1.54e-17	85.5	441	0.133	0.107	Q5A7R0_CANAL Phosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C300570CA PE=4 SV=1
19	Q9GZU7	1.01e-16	80.9	261	0.201	0.272	CTDS1_HUMAN Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 OS=Homo sapiens OX=9606 GN=CTDSP1 PE=1 SV=1
20	H7C1Z7	1.13e-16	80.9	262	0.144	0.195	H7C1Z7_HUMAN protein-serine/threonine phosphatase (Fragment) OS=Homo sapiens OX=9606 GN=CTDSP1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03031 NIF	5.2e-32	122.2	NLI interacting factor-like phosphatase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000445806

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000169551	0.999	Mitochondrial import inner membrane translocase subunit Tim21
2	9606.ENSP00000356256	0.999	Mitochondrial import inner membrane translocase subunit Tim17-A
3	9606.ENSP00000464522	0.997	Mitochondrial import inner membrane translocase subunit Tim23
4	9606.ENSP00000379999	0.994	Translocase of inner mitochondrial membrane 17B
5	9606.ENSP00000410339	0.994	Mitochondrial import receptor subunit TOM40 homolog
6	9606.ENSP00000270538	0.986	Mitochondrial import inner membrane translocase subunit TIM44
7	9606.ENSP00000315693	0.986	Mitochondrial import inner membrane translocase subunit TIM16
8	9606.ENSP00000216034	0.979	Mitochondrial import receptor subunit TOM22 homolog
9	9606.ENSP00000257245	0.968	Mitochondrial import inner membrane translocase subunit Tim10
10	9606.ENSP00000363211	0.967	Translocase of inner mitochondrial membrane 23 homolog B
11	9606.ENSP00000372005	0.958	Mitochondrial import inner membrane translocase subunit TIM14
12	9606.ENSP00000249269	0.955	Mitochondrial-processing peptidase subunit beta
13	9606.ENSP00000215570	0.951	Mitochondrial import inner membrane translocase subunit Tim13
14	9606.ENSP00000284320	0.951	Mitochondrial import receptor subunit TOM70
15	9606.ENSP00000360782	0.947	Mitochondrial-processing peptidase subunit alpha
16	9606.ENSP00000356967	0.941	Mitochondrial import receptor subunit TOM40B
17	9606.ENSP00000351214	0.928	Mitochondrial import receptor subunit TOM7 homolog
18	9606.ENSP00000297185	0.926	Stress-70 protein, mitochondrial
19	9606.ENSP00000370808	0.918	ADP/ATP translocase 3
20	9606.ENSP00000264954	0.892	GrpE protein homolog 1, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0004721	0.998	phosphoprotein phosphatase activity
GO:0004722	0.994	protein serine/threonine phosphatase activity
GO:0005102	0.988	signaling receptor binding
GO:0044877	0.815	protein-containing complex binding
GO:0005126	0.778	cytokine receptor binding
GO:0043021	0.768	ribonucleoprotein complex binding
GO:0070851	0.719	growth factor receptor binding
GO:0004725	0.578	protein tyrosine phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0071704	0.975	organic substance metabolic process
GO:0071840	0.971	cellular component organization or biogenesis
GO:0050794	0.967	regulation of cellular process
GO:0007005	0.963	mitochondrion organization
GO:0044237	0.959	cellular metabolic process
GO:0044238	0.958	primary metabolic process
GO:0006807	0.955	nitrogen compound metabolic process
GO:1901564	0.908	organonitrogen compound metabolic process
GO:0006915	0.898	apoptotic process
GO:0061024	0.890	membrane organization
GO:0006796	0.593	phosphate-containing compound metabolic process
GO:0043170	0.524	macromolecule metabolic process
GO:0016311	0.446	dephosphorylation
GO:0006470	0.442	protein dephosphorylation
GO:0007006	0.421	mitochondrial membrane organization
GO:0050896	0.402	response to stimulus
GO:0051716	0.309	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0005634	0.974	nucleus
GO:0070013	0.973	intracellular organelle lumen
GO:0005654	0.882	nucleoplasm
GO:0031975	0.865	envelope
GO:0005740	0.858	mitochondrial envelope
GO:0016020	0.850	membrane
GO:0031090	0.597	organelle membrane
GO:0031966	0.566	mitochondrial membrane
GO:0032991	0.526	protein-containing complex
GO:0005743	0.368	mitochondrial inner membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.-	0.998	Phosphoric monoester hydrolases.
EC:3.1.3.16	0.994	protein-serine/threonine phosphatase.
RHEA:10684	0.578	H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
EC:3.1.3.48	0.578	protein-tyrosine-phosphatase.

[back to server]