StarFunc result for job id Q3ZCX4

User Input

>input (644 residues)
MTSQSSVISNSCVTMERLSHMMERKAWCSQESALSEEEEDTTRPLETVTFKDVAVDLTQE
EWEQMKPAQRNLYRDVMLENYSNLVTVGCQVTKPDVIFKLEQEEEPWVMEEEMFGRHCPE
VWEVDEQIKKQQETLVRKVTSISKKILIKEKVIECKKVAKIFPLSSDIVTSRQSFYDCDS
LDKGLEHNLDLLRYEKGCVREKQSNEFGKPFYHCASYVVTPFKCNQCGQDFSHKFDLIRH
ERIHAGEKPYECKECGKAFSRKENLITHQKIHTGEKPYKCNECGKAFIQMSNLIRHHRIH
TGEKPYACKDCWKAFSQKSNLIEHERIHTGEKPYECKECGKSFSQKQNLIEHEKIHTGEK
PYACNECGRAFSRMSSVTLHMRSHTGEKPYKCNKCGKAFSQCSVFIIHMRSHTGEKPYVC
SECGKAFSQSSSLTVHMRNHTAEKPYECKECGKAFSRKENLITHQKIHTGEKPYECSECG
KAFIQMSNLIRHQRIHTGEKPYACTVCGKAFSQKSNLTEHEKIHTGEKPYHCNQCGKAFS
QRQNLLEHEKIHTGEKPFKCNECGKAFSRISSLTLHVRSHTGEKPYECNKCGKAFSQCSL
LIIHMRSHTGEKPFECNECGKAFSQRASLSIHKRGHTGERHQVY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5MCW4	0.468	0.443	2.116E-74	686	0.669	0.628	Q5MCW4.pdb.gz	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
2	AFDB:Q9P2J8	0.551	0.423	6.510E-66	865	0.470	0.350	Q9P2J8.pdb.gz	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
3	AFDB:P51523	0.546	0.483	3.887E-65	738	0.505	0.440	P51523.pdb.gz	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
4	AFDB:Q6ECI4	0.545	0.495	5.998E-64	717	0.502	0.450	Q6ECI4.pdb.gz	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
5	AFDB:P52742	0.509	0.501	1.466E-63	658	0.486	0.476	P52742.pdb.gz	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
6	AFDB:P51814	0.415	0.349	3.203E-63	821	0.488	0.382	P51814.pdb.gz	ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens OX=9606 GN=ZNF41 PE=1 SV=2
7	AFDB:Q9BX82	0.532	0.546	4.735E-63	626	0.464	0.478	Q9BX82.pdb.gz	ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens OX=9606 GN=ZNF471 PE=2 SV=1
8	AFDB:Q14587	0.466	0.338	8.751E-63	947	0.506	0.344	Q14587.pdb.gz	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
9	AFDB:O75290	0.393	0.395	6.533E-62	641	0.457	0.459	O75290.pdb.gz	Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens OX=9606 GN=ZNF780A PE=1 SV=3
10	AFDB:A0A0U1RQ46	0.583	0.614	9.533E-61	609	0.444	0.470	A0A0U1RQ46.pdb.gz	A0A0U1RQ46_MOUSE Zinc finger protein 950 OS=Mus musculus OX=10090 GN=Zfp950 PE=4 SV=1
11	PDB:3w5kB	0.080	0.278	7.598E-5	110	0.064	0.373	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:7td5A	0.076	0.094	7.211E-1	497	0.076	0.099	7td5A.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
13	PDB:6o9lQ	0.046	0.066	7.625E-1	430	0.071	0.107	6o9lQ.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
14	PDB:8ap8d	0.064	0.113	8.526E-1	270	0.056	0.133	8ap8d.pdb.gz
15	PDB:6edtJ	0.043	0.150	9.533E-1	109	0.025	0.147	6edtJ.pdb.gz	Structures of an RNA polymerase promoter melting intermediate elucidate DNA unwinding.
16	PDB:8escE	0.046	0.060	1.127	440	0.092	0.134	8escE.pdb.gz	Structure and flexibility of the yeast NuA4 histone acetyltransferase complex.
17	PDB:5yzgY	0.049	0.105	1.260	204	0.050	0.157	5yzgY.pdb.gz	Structure of a human catalytic step I spliceosome
18	PDB:6wkrC	0.075	0.079	1.333	606	0.081	0.086	6wkrC.pdb.gz	JARID2 and AEBP2 regulate PRC2 in the presence of H2AK119ub1 and other histone modifications.
19	PDB:7uhyC	0.050	0.053	1.333	578	0.053	0.059	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
20	PDB:4v6wCg	0.053	0.163	1.409	113	0.023	0.133	4v6wCg.pdb.gz	Structures of the human and Drosophila 80S ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A087WSF4	532	635	0.438	0.444	A0A087WSF4_MOUSE Zinc finger protein 976 OS=Mus musculus OX=10090 GN=Zfp976 PE=4 SV=1
2	A0A0A0MS50	564	604	0.461	0.492	A0A0A0MS50_HUMAN Zinc finger protein 300 OS=Homo sapiens OX=9606 GN=ZNF300 PE=1 SV=1
3	A0A0U1RQ46	577	609	0.460	0.486	A0A0U1RQ46_MOUSE Zinc finger protein 950 OS=Mus musculus OX=10090 GN=Zfp950 PE=4 SV=1
4	A6NNF4	566	616	0.477	0.498	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
5	E9Q981	533	636	0.438	0.443	E9Q981_MOUSE Zinc finger protein 976 OS=Mus musculus OX=10090 GN=Zfp976 PE=4 SV=1
6	O75290	568	641	0.457	0.459	Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens OX=9606 GN=ZNF780A PE=1 SV=3
7	O75437	539	659	0.463	0.452	ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens OX=9606 GN=ZNF254 PE=2 SV=3
8	O94892	586	652	0.480	0.474	ZN432_HUMAN Zinc finger protein 432 OS=Homo sapiens OX=9606 GN=ZNF432 PE=1 SV=1
9	P15620	535	580	0.399	0.443	ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus OX=10090 GN=Znf271 PE=2 SV=1
10	P15622	536	560	0.444	0.511	ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens OX=9606 GN=ZNF250 PE=1 SV=3
11	P17014	582	697	0.494	0.456	ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens OX=9606 GN=ZNF12 PE=1 SV=3
12	P17020	539	682	0.421	0.397	ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens OX=9606 GN=ZNF16 PE=1 SV=3
13	P17038	547	809	0.498	0.397	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
14	P17097	532	686	0.464	0.436	ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens OX=9606 GN=ZNF7 PE=1 SV=1
15	P35789	582	620	0.483	0.502	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
16	P51523	566	738	0.441	0.385	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
17	P51814	538	821	0.416	0.326	ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens OX=9606 GN=ZNF41 PE=1 SV=2
18	P52742	607	658	0.506	0.495	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
19	Q02386	550	682	0.467	0.441	ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens OX=9606 GN=ZNF45 PE=1 SV=2
20	Q03923	568	595	0.477	0.516	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07975 C1_4	6.4	18.4	TFIIH C1-like domain
2	PF07754 HVO_2753_ZBP	0.79	20.9	Small zinc finger protein HVO_2753-like, Zn-binding pocket
3	PF01352 KRAB	2.2e-21	86.5	KRAB box
4	PF10484 MRP-S23	0.21	23.3	Mitochondrial ribosomal protein S23
5	PF01286 XPA_N	2.1	19.8	XPA protein N-terminal
6	PF14149 YhfH	62	15.0	YhfH-like protein
7	PF01428 zf-AN1	0.64	21.5	AN1-like Zinc finger
8	PF00096 zf-C2H2	7.9e-90	301.7	Zinc finger, C2H2 type
9	PF16622 zf-C2H2_11	0.0003	31.8	zinc-finger C2H2-type
10	PF13894 zf-C2H2_4	5.2e-49	171.6	C2H2-type zinc finger
11	PF13912 zf-C2H2_6	1e-29	113.2	C2H2-type zinc finger
12	PF12171 zf-C2H2_jaz	7.1e-08	43.8	Zinc-finger double-stranded RNA-binding
13	PF16278 zf-C2HE	0.92	21.4	C2HE / C2H2 / C2HC zinc-binding finger
14	PF13465 zf-H2C2_2	5.2e-128	423.7	Zinc-finger double domain
15	PF18508 zf_C2H2_13	0.72	20.8	Zinc finger domain
16	PF18439 zf_UBZ	0.0087	27.0	Ubiquitin-Binding Zinc Finger
17	PF17032 zinc_ribbon_15	2.4e-05	36.3	zinc-ribbon family
18	PF09723 Zn-ribbon_8	5.1e-15	66.6	Zinc ribbon domain
19	PF17283 Zn_ribbon_SprT	57	15.1	SprT-like zinc ribbon domain
20	PF12760 Zn_Tnp_IS1595	37	15.7	Transposase zinc-ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000481819

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000300650	0.560	Ring finger protein 214
2	9606.ENSP00000222033	0.519	E3 ubiquitin-protein ligase ZNRF4
3	9606.ENSP00000456782	0.519	Palmitoyltransferase
4	9606.ENSP00000287218	0.510	Zinc finger AN1-type containing 3
5	9606.ENSP00000374490	0.502	Dynein heavy chain 17, axonemal

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0031323	0.979	regulation of cellular metabolic process
GO:0051171	0.973	regulation of nitrogen compound metabolic process
GO:0080090	0.954	regulation of primary metabolic process
GO:0010556	0.943	regulation of macromolecule biosynthetic process
GO:0051252	0.937	regulation of RNA metabolic process
GO:0010468	0.867	regulation of gene expression
GO:0009987	0.849	cellular process
GO:2001141	0.829	regulation of RNA biosynthetic process
GO:1903506	0.669	regulation of nucleic acid-templated transcription
GO:0006355	0.640	regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005654	0.993	nucleoplasm
GO:0005737	0.953	cytoplasm
GO:0043232	0.360	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]