StarFunc result for job id Q401N2

User Input

>input (412 residues)
MMALWSLLHLTFLGFSITLLLVHGQGFQGTAAIWPSLFNVNLSKKVQESIQIPNNGSAPL
LVDVRVFVSNVFNVDILRYTMSSMLLLRLSWLDTRLAWNTSAHPRHAITLPWESLWTPRL
TILEALWVDWRDQSPQARVDQDGHVKLNLALATETNCNFELLHFPRDHSNCSLSFYALSN
TAMELEFQAHVVNEIVSVKREYVVYDLKTQVPPQQLVPCFQVTLRLKNTALKSIIALLVP
AEALLLADVCGGLLPLRAIERIGYKVTLLLSYLVLHSSLVQALPSSSSCNPLLIYYFTIL
LLLLFLSTIETVLLAGLLARGNLGAKSGPSPAPRGEQREHGNPGPHPAEEPSRGVKGSQR
SWPETADRIFFLVYVVGVLCTQFVFAGIWMWAACKSDAAPGEAAPHGRRPRL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q401N2	1.000	1.000	2.104E-79	412	1.000	1.000	Q401N2.pdb.gz	ZACN_HUMAN Zinc-activated ligand-gated ion channel OS=Homo sapiens OX=9606 GN=ZACN PE=1 SV=2
2	AFDB:O70212	0.683	0.579	4.229E-26	490	0.235	0.198	O70212.pdb.gz	5HT3A_CAVPO 5-hydroxytryptamine receptor 3A OS=Cavia porcellus OX=10141 GN=HTR3A PE=2 SV=1
3	AFDB:P23979	0.671	0.573	4.229E-26	487	0.228	0.193	P23979.pdb.gz	5HT3A_MOUSE 5-hydroxytryptamine receptor 3A OS=Mus musculus OX=10090 GN=Htr3a PE=1 SV=2
4	AFDB:Q9JHJ5	0.625	0.592	6.702E-26	437	0.223	0.211	Q9JHJ5.pdb.gz	5HT3B_MOUSE 5-hydroxytryptamine receptor 3B OS=Mus musculus OX=10090 GN=Htr3b PE=2 SV=1
5	AFDB:Q8WXA8	0.665	0.617	5.027E-25	447	0.218	0.201	Q8WXA8.pdb.gz	5HT3C_HUMAN 5-hydroxytryptamine receptor 3C OS=Homo sapiens OX=9606 GN=HTR3C PE=1 SV=2
6	AFDB:Q9I8C7	0.599	0.548	5.324E-25	452	0.206	0.188	Q9I8C7.pdb.gz	ACH10_CHICK Neuronal acetylcholine receptor subunit alpha-10 OS=Gallus gallus OX=9031 GN=CHRNA10 PE=3 SV=1
7	AFDB:P22771	0.665	0.610	5.640E-25	452	0.165	0.150	P22771.pdb.gz	GLRA2_RAT Glycine receptor subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Glra2 PE=1 SV=1
8	AFDB:O95264	0.665	0.625	8.439E-25	441	0.192	0.179	O95264.pdb.gz	5HT3B_HUMAN 5-hydroxytryptamine receptor 3B OS=Homo sapiens OX=9606 GN=HTR3B PE=1 SV=1
9	AFDB:P36544	0.622	0.514	1.192E-24	502	0.211	0.173	P36544.pdb.gz	ACHA7_HUMAN Neuronal acetylcholine receptor subunit alpha-7 OS=Homo sapiens OX=9606 GN=CHRNA7 PE=1 SV=5
10	AFDB:Q15825	0.617	0.518	1.192E-24	494	0.211	0.176	Q15825.pdb.gz	ACHA6_HUMAN Neuronal acetylcholine receptor subunit alpha-6 OS=Homo sapiens OX=9606 GN=CHRNA6 PE=1 SV=1
11	PDB:6i53B	0.651	0.781	7.720E-20	338	0.150	0.183	6i53B.pdb.gz	Cryo-EM structure of the human alpha 1 beta 3 gamma 2 GABAAreceptor in a lipid bilayer.
12	PDB:6i53A	0.605	0.704	3.870E-19	349	0.138	0.163	6i53A.pdb.gz	Cryo-EM structure of the human alpha 1 beta 3 gamma 2 GABAAreceptor in a lipid bilayer.
13	PDB:4hfcA	0.595	0.770	2.176E-18	311	0.117	0.154	4hfcA.pdb.gz	Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
14	PDB:7kuyE	0.611	0.728	1.940E-17	338	0.133	0.163	7kuyE.pdb.gz	Characterization of the subunit composition and structure of adult human glycine receptors
15	PDB:4aq5E	0.551	0.607	1.297E-13	370	0.136	0.151	4aq5E.pdb.gz
16	PDB:7l6qA	0.519	0.672	3.873E-13	311	0.102	0.135	7l6qA.pdb.gz	Structure and function at the lipid-protein interface of a pentameric ligand-gated ion channel.
17	PDB:2w8gC	0.361	0.651	1.374E-12	217	0.080	0.152	2w8gC.pdb.gz	Use of Acetylcholine Binding Protein in the Search for Novel Alpha7 Nicotinic Receptor Ligands. In Silico Docking, Pharmacological Screening, and X- Ray Analysis.
18	PDB:4afhA	0.349	0.635	1.941E-11	213	0.078	0.150	4afhA.pdb.gz	Molecular Actions of Smoking Cessation Drugs at Alpha4Beta2 Nicotinic Receptors Defined in Crystal Structures of a Homologous Binding Protein.
19	PDB:6zgdA	0.512	0.697	1.941E-11	288	0.114	0.163	6zgdA.pdb.gz
20	PDB:4wz9B	0.111	0.068	9.194E-5	887	0.058	0.027	4wz9B.pdb.gz	The Anopheles-midgut APN1 structure reveals a new malaria transmission-blocking vaccine epitope.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q401N2	0.0	838	412	1.000	1.000	ZACN_HUMAN Zinc-activated ligand-gated ion channel OS=Homo sapiens OX=9606 GN=ZACN PE=1 SV=2
2	A5X5Y0	2.71e-23	103	456	0.238	0.215	5HT3E_HUMAN 5-hydroxytryptamine receptor 3E OS=Homo sapiens OX=9606 GN=HTR3E PE=1 SV=1
3	Q8WXA8	4.83e-23	102	447	0.209	0.192	5HT3C_HUMAN 5-hydroxytryptamine receptor 3C OS=Homo sapiens OX=9606 GN=HTR3C PE=1 SV=2
4	P46098	1.53e-22	101	478	0.187	0.161	5HT3A_HUMAN 5-hydroxytryptamine receptor 3A OS=Homo sapiens OX=9606 GN=HTR3A PE=1 SV=1
5	P35563	2.69e-22	100	483	0.197	0.168	5HT3A_RAT 5-hydroxytryptamine receptor 3A OS=Rattus norvegicus OX=10116 GN=Htr3a PE=1 SV=2
6	Q9JHJ5	1.14e-21	98.6	437	0.214	0.201	5HT3B_MOUSE 5-hydroxytryptamine receptor 3B OS=Mus musculus OX=10090 GN=Htr3b PE=2 SV=1
7	Q9JJ16	3.14e-21	97.4	437	0.214	0.201	5HT3B_RAT 5-hydroxytryptamine receptor 3B OS=Rattus norvegicus OX=10116 GN=Htr3b PE=1 SV=1
8	O95264	3.98e-21	97.1	441	0.192	0.179	5HT3B_HUMAN 5-hydroxytryptamine receptor 3B OS=Homo sapiens OX=9606 GN=HTR3B PE=1 SV=1
9	O70212	5.54e-21	97.1	490	0.199	0.167	5HT3A_CAVPO 5-hydroxytryptamine receptor 3A OS=Cavia porcellus OX=10141 GN=HTR3A PE=2 SV=1
10	P23979	1.28e-18	89.7	487	0.189	0.160	5HT3A_MOUSE 5-hydroxytryptamine receptor 3A OS=Mus musculus OX=10090 GN=Htr3a PE=1 SV=2
11	Q9I8C7	6.48e-15	78.6	452	0.197	0.179	ACH10_CHICK Neuronal acetylcholine receptor subunit alpha-10 OS=Gallus gallus OX=9031 GN=CHRNA10 PE=3 SV=1
12	P32297	7.33e-14	75.5	505	0.158	0.129	ACHA3_HUMAN Neuronal acetylcholine receptor subunit alpha-3 OS=Homo sapiens OX=9606 GN=CHRNA3 PE=1 SV=4
13	Q866A2	1.01e-13	75.1	502	0.163	0.133	ACHA7_MACMU Neuronal acetylcholine receptor subunit alpha-7 OS=Macaca mulatta OX=9544 GN=CHRNA7 PE=2 SV=1
14	P36544	1.20e-13	74.7	502	0.163	0.133	ACHA7_HUMAN Neuronal acetylcholine receptor subunit alpha-7 OS=Homo sapiens OX=9606 GN=CHRNA7 PE=1 SV=5
15	P43143	4.15e-13	73.2	493	0.150	0.126	ACHA6_RAT Neuronal acetylcholine receptor subunit alpha-6 OS=Rattus norvegicus OX=10116 GN=Chrna6 PE=2 SV=1
16	Q8BMN3	9.65e-13	71.6	464	0.172	0.153	ACHB3_MOUSE Neuronal acetylcholine receptor subunit beta-3 OS=Mus musculus OX=10090 GN=Chrnb3 PE=2 SV=1
17	Q9R0W9	1.13e-12	71.6	494	0.150	0.126	ACHA6_MOUSE Neuronal acetylcholine receptor subunit alpha-6 OS=Mus musculus OX=10090 GN=Chrna6 PE=2 SV=2
18	P12391	1.32e-12	71.2	464	0.167	0.149	ACHB3_RAT Neuronal acetylcholine receptor subunit beta-3 OS=Rattus norvegicus OX=10116 GN=Chrnb3 PE=2 SV=1
19	Q05941	1.34e-12	71.6	502	0.158	0.129	ACHA7_RAT Neuronal acetylcholine receptor subunit alpha-7 OS=Rattus norvegicus OX=10116 GN=Chrna7 PE=1 SV=2
20	P49582	1.41e-12	71.2	502	0.158	0.129	ACHA7_MOUSE Neuronal acetylcholine receptor subunit alpha-7 OS=Mus musculus OX=10090 GN=Chrna7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02931 Neur_chan_LBD	1e-17	75.8	Neurotransmitter-gated ion-channel ligand binding domain
2	PF02932 Neur_chan_memb	0.017	26.8	Neurotransmitter-gated ion-channel transmembrane region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000334854

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000329684	0.788	Galanin receptor type 2
2	9606.ENSP00000334100	0.765	Exocyst complex component 7
3	9606.ENSP00000480744	0.502	Zinc finger protein 385C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030594	0.998	neurotransmitter receptor activity
GO:0005230	0.998	extracellular ligand-gated monoatomic ion channel activity
GO:0008270	0.997	zinc ion binding
GO:0004888	0.984	transmembrane signaling receptor activity
GO:0022835	0.926	transmitter-gated channel activity
GO:0022824	0.924	transmitter-gated monoatomic ion channel activity
GO:0005515	0.834	protein binding
GO:0005231	0.513	excitatory extracellular ligand-gated monoatomic ion channel activity
GO:0005261	0.481	monoatomic cation channel activity
GO:0098960	0.399	postsynaptic neurotransmitter receptor activity
GO:0099094	0.379	ligand-gated monoatomic cation channel activity
GO:1904315	0.341	transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0051179	0.995	localization
GO:0009987	0.995	cellular process
GO:0006810	0.994	transport
GO:0042221	0.986	response to chemical
GO:0055085	0.837	transmembrane transport
GO:0050794	0.816	regulation of cellular process
GO:0006811	0.716	monoatomic ion transport
GO:0010043	0.572	response to zinc ion
GO:0034220	0.552	monoatomic ion transmembrane transport
GO:0007154	0.403	cell communication
GO:0023052	0.386	signaling
GO:0051716	0.360	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043226	0.638	organelle
GO:0032991	0.513	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]