StarFunc result for job id Q460N3

User Input

>input (678 residues)
MAAPGPLPAAALSPGAPTPRELMHGVAGVTSRAGRDREAGSVLPAGNRGARKASRRSSSR
SMSRDNKFSKKDCLSIRNVVASIQTKEGLNLKLISGDVLYIWADVIVNSVPMNLQLGGGP
LSRAFLQKAGPMLQKELDDRRRETEEKVGNIFMTSGCNLDCKAVLHAVAPYWNNGAETSW
QIMANIIKKCLTTVEVLSFSSITFPMIGTGSLQFPKAVFAKLILSEVFEYSSSTRPITSP
LQEVHFLVYTNDDEGCQAFLDEFTNWSRINPNKARIPMAGDTQGVVGTVSKPCFTAYEMK
IGAITFQVATGDIATEQVDVIVNSTARTFNRKSGVSRAILEGAGQAVESECAVLAAQPHR
DFIITPGGCLKCKIIIHVPGGKDVRKTVTSVLEECEQRKYTSVSLPAIGTGNAGKNPITV
ADNIIDAIVDFSSQHSTPSLKTVKVVIFQPELLNIFYDSMKKRDLSASLNFQSTFSMTTC
NLPEHWTDMNHQLFCMVQLEPGQSEYNTIKDKFTRTCSSYAIEKIERIQNAFLWQSYQVK
KRQMDIKNDHKNNERLLFHGTDADSVPYVNQHGFNRSCAGKNAVSYGKGTYFAVDASYSA
KDTYSKPDSNGRKHMYVVRVLTGVFTKGRAGLVTPPPKNPHNPTDLFDSVTNNTRSPKLF
VVFFDNQAYPEYLITFTA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q460N3	1.000	1.000	0.000	678	1.000	1.000	Q460N3.pdb.gz	PAR15_HUMAN Protein mono-ADP-ribosyltransferase PARP15 OS=Homo sapiens OX=9606 GN=PARP15 PE=1 SV=2
2	AFDB:Q460N5	0.289	0.109	5.066E-81	1801	0.507	0.191	Q460N5.pdb.gz	PAR14_HUMAN Protein mono-ADP-ribosyltransferase PARP14 OS=Homo sapiens OX=9606 GN=PARP14 PE=1 SV=3
3	AFDB:Q2EMV9	0.289	0.108	1.014E-78	1817	0.478	0.178	Q2EMV9.pdb.gz	PAR14_MOUSE Protein mono-ADP-ribosyltransferase PARP14 OS=Mus musculus OX=10090 GN=Parp14 PE=1 SV=3
4	AFDB:Q8IXQ6	0.266	0.213	6.075E-45	854	0.252	0.200	Q8IXQ6.pdb.gz	PARP9_HUMAN Protein mono-ADP-ribosyltransferase PARP9 OS=Homo sapiens OX=9606 GN=PARP9 PE=1 SV=2
5	AFDB:Q8CAS9	0.276	0.222	2.611E-43	866	0.232	0.181	Q8CAS9.pdb.gz	PARP9_MOUSE Protein mono-ADP-ribosyltransferase PARP9 OS=Mus musculus OX=10090 GN=Parp9 PE=1 SV=2
6	AFDB:Q55AK6	0.273	0.117	4.726E-27	1618	0.198	0.083	Q55AK6.pdb.gz	Q55AK6_DICDI Poly [ADP-ribose] polymerase OS=Dictyostelium discoideum OX=44689 GN=pARTg PE=4 SV=1
7	AFDB:Q9H0J9	0.288	0.279	3.663E-21	701	0.119	0.116	Q9H0J9.pdb.gz	PAR12_HUMAN Protein mono-ADP-ribosyltransferase PARP12 OS=Homo sapiens OX=9606 GN=PARP12 PE=1 SV=1
8	AFDB:E9PNI7	0.278	0.184	2.024E-20	1037	0.108	0.070	E9PNI7.pdb.gz	E9PNI7_HUMAN Poly [ADP-ribose] polymerase OS=Homo sapiens OX=9606 GN=PARP10 PE=1 SV=1
9	AFDB:Q9NR21	0.279	0.550	1.327E-19	338	0.117	0.234	Q9NR21.pdb.gz	PAR11_HUMAN Protein mono-ADP-ribosyltransferase PARP11 OS=Homo sapiens OX=9606 GN=PARP11 PE=1 SV=2
10	AFDB:O75367	0.264	0.473	1.887E-17	372	0.081	0.148	O75367.pdb.gz	H2AY_HUMAN Core histone macro-H2A.1 OS=Homo sapiens OX=9606 GN=MACROH2A1 PE=1 SV=5
11	PDB:5cb5R	0.241	0.907	3.197E-12	173	0.072	0.283	5cb5R.pdb.gz	Structural insights into the mechanism of Escherichia coli YmdB: A 2'-O-acetyl-ADP-ribose deacetylase
12	PDB:6y4zA	0.236	0.698	5.521E-11	221	0.066	0.204	6y4zA.pdb.gz
13	PDB:6fx7A	0.247	0.824	9.760E-11	194	0.063	0.222	6fx7A.pdb.gz	Crystal structure of in vitro evolved Af1521
14	PDB:6x0lP	0.203	0.283	7.415E-9	474	0.077	0.110	6x0lP.pdb.gz	Bridging of DNA breaks activates PARP2-HPF1 to modify chromatin.
15	PDB:1gytA	0.208	0.270	3.186E-7	503	0.084	0.113	1gytA.pdb.gz	X-Ray Structure of Aminopeptidase a from Escherichia Coli and a Model for the Nucleoprotein Complex in Xer Site-Specific Recombination
16	PDB:6lfqA	0.184	0.637	1.030E-5	169	0.035	0.142	6lfqA.pdb.gz
17	PDB:4ksiA	0.194	0.246	6.377E-5	517	0.069	0.091	4ksiA.pdb.gz	Structure of tomato wound-induced leucine aminopeptidase sheds light on substrate specificity.
18	PDB:2lgrA	0.177	0.685	1.338E-4	152	0.029	0.132	2lgrA.pdb.gz
19	PDB:5jwqA	0.163	0.234	1.883E-4	413	0.063	0.104	5jwqA.pdb.gz	Structural basis of the day-night transition in a bacterial circadian clock.
20	PDB:2ewbA	0.180	0.243	3.524E-4	486	0.065	0.091	2ewbA.pdb.gz	Metal Ion Substitution in the Catalytic Site Greatly Affects the Binding of Sulfhydryl-Containing Compounds to Leucyl Aminopeptidase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q460N3	0.0	1418	678	1.000	1.000	PAR15_HUMAN Protein mono-ADP-ribosyltransferase PARP15 OS=Homo sapiens OX=9606 GN=PARP15 PE=1 SV=2
2	Q460N5	3.03e-123	405	1801	0.308	0.116	PAR14_HUMAN Protein mono-ADP-ribosyltransferase PARP14 OS=Homo sapiens OX=9606 GN=PARP14 PE=1 SV=3
3	Q2EMV9	1.09e-117	389	1817	0.301	0.112	PAR14_MOUSE Protein mono-ADP-ribosyltransferase PARP14 OS=Mus musculus OX=10090 GN=Parp14 PE=1 SV=3
4	A0A0R4IVH6	2.84e-36	147	646	0.119	0.125	A0A0R4IVH6_DANRE TCDD-inducible poly [ADP-ribose] polymerase OS=Danio rerio OX=7955 GN=fc03g05 PE=3 SV=1
5	A0A8I6GA83	4.62e-35	144	688	0.130	0.128	A0A8I6GA83_RAT TCDD-inducible poly(ADP-ribose) polymerase OS=Rattus norvegicus OX=10116 GN=Tiparp PE=3 SV=1
6	Q8C1B2	4.75e-35	143	657	0.130	0.134	PARPT_MOUSE Protein mono-ADP-ribosyltransferase TIPARP OS=Mus musculus OX=10090 GN=Tiparp PE=2 SV=1
7	Q9H0J9	5.09e-35	144	701	0.124	0.120	PAR12_HUMAN Protein mono-ADP-ribosyltransferase PARP12 OS=Homo sapiens OX=9606 GN=PARP12 PE=1 SV=1
8	D3ZMH5	5.30e-35	143	657	0.130	0.134	D3ZMH5_RAT TCDD-inducible poly(ADP-ribose) polymerase OS=Rattus norvegicus OX=10116 GN=Tiparp PE=3 SV=1
9	E9PK67	5.74e-35	144	1016	0.099	0.066	E9PK67_HUMAN Poly [ADP-ribose] polymerase OS=Homo sapiens OX=9606 GN=PARP10 PE=1 SV=1
10	Q53GL7	6.17e-35	144	1025	0.099	0.065	PAR10_HUMAN Protein mono-ADP-ribosyltransferase PARP10 OS=Homo sapiens OX=9606 GN=PARP10 PE=1 SV=2
11	E9PNI7	6.24e-35	144	1037	0.099	0.065	E9PNI7_HUMAN Poly [ADP-ribose] polymerase OS=Homo sapiens OX=9606 GN=PARP10 PE=1 SV=1
12	Q05BQ2	1.26e-34	142	660	0.124	0.127	Q05BQ2_HUMAN TIPARP protein (Fragment) OS=Homo sapiens OX=9606 GN=TIPARP PE=2 SV=1
13	Q7Z3E1	1.59e-34	142	657	0.124	0.128	PARPT_HUMAN Protein mono-ADP-ribosyltransferase TIPARP OS=Homo sapiens OX=9606 GN=TIPARP PE=1 SV=1
14	F1N973	1.89e-34	141	670	0.121	0.122	F1N973_CHICK TCDD inducible poly(ADP-ribose) polymerase OS=Gallus gallus OX=9031 GN=TIPARP PE=3 SV=2
15	Q9NR21	1.31e-30	125	338	0.114	0.228	PAR11_HUMAN Protein mono-ADP-ribosyltransferase PARP11 OS=Homo sapiens OX=9606 GN=PARP11 PE=1 SV=2
16	Q8CFF0	2.21e-30	124	331	0.114	0.233	PAR11_MOUSE Protein mono-ADP-ribosyltransferase PARP11 OS=Mus musculus OX=10090 GN=Parp11 PE=2 SV=1
17	Q8IXQ6	1.72e-29	127	854	0.174	0.138	PARP9_HUMAN Protein mono-ADP-ribosyltransferase PARP9 OS=Homo sapiens OX=9606 GN=PARP9 PE=1 SV=2
18	Q8CAS9	5.29e-26	116	866	0.180	0.141	PARP9_MOUSE Protein mono-ADP-ribosyltransferase PARP9 OS=Mus musculus OX=10090 GN=Parp9 PE=1 SV=2
19	C9J6P4	4.70e-22	103	1024	0.106	0.070	C9J6P4_HUMAN Zinc finger CCCH-type containing, antiviral 1 OS=Homo sapiens OX=9606 GN=ZC3HAV1 PE=1 SV=1
20	Q7Z2W4	6.09e-22	103	902	0.106	0.080	ZCCHV_HUMAN Zinc finger CCCH-type antiviral protein 1 OS=Homo sapiens OX=9606 GN=ZC3HAV1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01661 Macro	2.2e-29	113.3	Macro domain
2	PF00644 PARP	9.7e-23	92.3	Poly(ADP-ribose) polymerase catalytic domain
3	PF01809 YidD	4.6e+02	12.1	Putative membrane protein insertion efficiency factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000417214

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261888	0.762	Mono [ADP-ribose] polymerase PARP16
2	9606.ENSP00000296161	0.743	E3 ubiquitin-protein ligase DTX3L
3	9606.ENSP00000371419	0.704	poly(ADP-ribose) polymerase family member 4
4	9606.ENSP00000381740	0.704	Poly [ADP-ribose] polymerase 3
5	9606.ENSP00000456348	0.688	poly(ADP-ribose) polymerase family member 6
6	9606.ENSP00000281631	0.685	poly(ADP-ribose) polymerase family member 8
7	9606.ENSP00000250416	0.669	Poly [ADP-ribose] polymerase 2
8	9606.ENSP00000358451	0.654	Ganglioside induced differentiation associated protein 2
9	9606.ENSP00000420484	0.637	O-acetyl-ADP-ribose deacetylase 1
10	9606.ENSP00000362273	0.634	Poly(ADP-ribose) glycohydrolase ARH3
11	9606.ENSP00000384408	0.634	Poly(ADP-ribose) glycohydrolase
12	9606.ENSP00000355759	0.628	Poly [ADP-ribose] polymerase 1
13	9606.ENSP00000378050	0.563	tRNA 2'-phosphotransferase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003714	0.999	transcription corepressor activity
GO:0003950	0.999	NAD+ ADP-ribosyltransferase activity
GO:1990404	0.999	NAD+-protein ADP-ribosyltransferase activity
GO:0070403	0.999	NAD+ binding
GO:0019899	0.561	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0080090	0.995	regulation of primary metabolic process
GO:0060255	0.995	regulation of macromolecule metabolic process
GO:0051171	0.995	regulation of nitrogen compound metabolic process
GO:0036211	0.995	protein modification process
GO:0043687	0.993	post-translational protein modification
GO:0010605	0.992	negative regulation of macromolecule metabolic process
GO:0045934	0.991	negative regulation of nucleobase-containing compound metabolic process
GO:0006355	0.985	regulation of DNA-templated transcription
GO:0010558	0.984	negative regulation of macromolecule biosynthetic process
GO:0031327	0.983	negative regulation of cellular biosynthetic process
GO:0006357	0.962	regulation of transcription by RNA polymerase II
GO:0045892	0.961	negative regulation of DNA-templated transcription
GO:0000122	0.934	negative regulation of transcription by RNA polymerase II
GO:0050896	0.542	response to stimulus
GO:0048518	0.479	positive regulation of biological process
GO:0048522	0.425	positive regulation of cellular process
GO:0009987	0.420	cellular process
GO:0044237	0.354	cellular metabolic process
GO:0048583	0.343	regulation of response to stimulus
GO:0070212	0.322	protein poly-ADP-ribosylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0031974	0.977	membrane-enclosed lumen
GO:0005654	0.966	nucleoplasm
GO:0043232	0.953	intracellular non-membrane-bounded organelle
GO:0005829	0.888	cytosol
GO:0005694	0.802	chromosome
GO:0016020	0.479	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.2.30	0.999	NAD(+) ADP-ribosyltransferase.

[back to server]