StarFunc result for job id Q460N5

User Input

>input (1801 residues)
MAVPGSFPLLVEGSWGPDPPKNLNTKLQMYFQSPKRSGGGECEVRQDPRSPSRFLVFFYP
EDVRQKVLERKNHELVWQGKGTFKLTVQLPATPDEIDHVFEEELLTKESKTKEDVKEPDV
SEELDTKLPLDGGLDKMEDIPEECENISSLVAFENLKANVTDIMLILLVENISGLSNDDF
QVEIIRDFDVAVVTFQKHIDTIRFVDDCTKHHSIKQLQLSPRLLEVTNTIRVENLPPGAD
DYSLKLFFENPYNGGGRVANVEYFPEESSALIEFFDRKVLDTIMATKLDFNKMPLSVFPY
YASLGTALYGKEKPLIKLPAPFEESLDLPLWKFLQKKNHLIEEINDEMRRCHCELTWSQL
SGKVTIRPAATLVNEGRPRIKTWQADTSTTLSSIRSKYKVNPIKVDPTMWDTIKNDVKDD
RILIEFDTLKEMVILAGKSEDVQSIEVQVRELIESTTQKIKREEQSLKEKMIISPGRYFL
LCHSSLLDHLLTECPEIEICYDRVTQHLCLKGPSADVYKAKCEIQEKVYTMAQKNIQVSP
EIFQFLQQVNWKEFSKCLFIAQKILALYELEGTTVLLTSCSSEALLEAEKQMLSALNYKR
IEVENKEVLHGKKWKGLTHNLLKKQNSSPNTVIINELTSETTAEVIITGCVKEVNETYKL
LFNFVEQNMKIERLVEVKPSLVIDYLKTEKKLFWPKIKKVNVQVSFNPENKQKGILLTGS
KTEVLKAVDIVKQVWDSVCVKSVHTDKPGAKQFFQDKARFYQSEIKRLFGCYIELQENEV
MKEGGSPAGQKCFSRTVLAPGVVLIVQQGDLARLPVDVVVNASNEDLKHYGGLAAALSKA
AGPELQADCDQIVKREGRLLPGNATISKAGKLPYHHVIHAVGPRWSGYEAPRCVYLLRRA
VQLSLCLAEKYKYRSIAIPAISSGVFGFPLGRCVETIVSAIKENFQFKKDGHCLKEIYLV
DVSEKTVEAFAEAVKTVFKATLPDTAAPPGLPPAAAGPGKTSWEKGSLVSPGGLQMLLVK
EGVQNAKTDVVVNSVPLDLVLSRGPLSKSLLEKAGPELQEELDTVGQGVAVSMGTVLKTS
SWNLDCRYVLHVVAPEWRNGSTSSLKIMEDIIRECMEITESLSLKSIAFPAIGTGNLGFP
KNIFAELIISEVFKFSSKNQLKTLQEVHFLLHPSDHENIQAFSDEFARRANGNLVSDKIP
KAKDTQGFYGTVSSPDSGVYEMKIGSIIFQVASGDITKEEADVIVNSTSNSFNLKAGVSK
AILECAGQNVERECSQQAQQRKNDYIITGGGFLRCKNIIHVIGGNDVKSSVSSVLQECEK
KNYSSICLPAIGTGNAKQHPDKVAEAIIDAIEDFVQKGSAQSVKKVKVVIFLPQVLDVFY
ANMKKREGTQLSSQQSVMSKLASFLGFSKQSPQKKNHLVLEKKTESATFRVCGENVTCVE
YAISWLQDLIEKEQCPYTSEDECIKDFDEKEYQELNELQKKLNINISLDHKRPLIKVLGI
SRDVMQARDEIEAMIKRVRLAKEQESRADCISEFIEWQYNDNNTSHCFNKMTNLKLEDAR
REKKKTVDVKINHRHYTVNLNTYTATDTKGHSLSVQRLTKSKVDIPAHWSDMKQQNFCVV
ELLPSDPEYNTVASKFNQTCSHFRIEKIERIQNPDLWNSYQAKKKTMDAKNGQTMNEKQL
FHGTDAGSVPHVNRNGFNRSYAGKNAVAYGKGTYFAVNANYSANDTYSRPDANGRKHVYY
VRVLTGIYTHGNHSLIVPPSKNPQNPTDLYDTVTDNVHHPSLFVAFYDYQAYPEYLITFR
K

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q2EMV9	0.401	0.398	0.000	1817	0.632	0.626	Q2EMV9.pdb.gz	PAR14_MOUSE Protein mono-ADP-ribosyltransferase PARP14 OS=Mus musculus OX=10090 GN=Parp14 PE=1 SV=3
2	AFDB:Q460N5	1.000	1.000	0.000	1801	1.000	1.000	Q460N5.pdb.gz	PAR14_HUMAN Protein mono-ADP-ribosyltransferase PARP14 OS=Homo sapiens OX=9606 GN=PARP14 PE=1 SV=3
3	AFDB:Q460N3	0.109	0.289	1.685E-74	678	0.192	0.509	Q460N3.pdb.gz	PAR15_HUMAN Protein mono-ADP-ribosyltransferase PARP15 OS=Homo sapiens OX=9606 GN=PARP15 PE=1 SV=2
4	AFDB:Q8CAS9	0.109	0.224	1.663E-50	866	0.130	0.270	Q8CAS9.pdb.gz	PARP9_MOUSE Protein mono-ADP-ribosyltransferase PARP9 OS=Mus musculus OX=10090 GN=Parp9 PE=1 SV=2
5	AFDB:Q8IXQ6	0.110	0.222	1.457E-49	854	0.138	0.290	Q8IXQ6.pdb.gz	PARP9_HUMAN Protein mono-ADP-ribosyltransferase PARP9 OS=Homo sapiens OX=9606 GN=PARP9 PE=1 SV=2
6	AFDB:Q55AK6	0.115	0.127	2.051E-32	1618	0.128	0.143	Q55AK6.pdb.gz	Q55AK6_DICDI Poly [ADP-ribose] polymerase OS=Dictyostelium discoideum OX=44689 GN=pARTg PE=4 SV=1
7	AFDB:E9PNI7	0.102	0.175	2.782E-30	1037	0.134	0.232	E9PNI7.pdb.gz	E9PNI7_HUMAN Poly [ADP-ribose] polymerase OS=Homo sapiens OX=9606 GN=PARP10 PE=1 SV=1
8	AFDB:F1N973	0.106	0.284	1.025E-24	670	0.049	0.133	F1N973.pdb.gz	F1N973_CHICK TCDD inducible poly(ADP-ribose) polymerase OS=Gallus gallus OX=9031 GN=TIPARP PE=3 SV=2
9	AFDB:A0A0R4IVH6	0.105	0.291	3.732E-24	646	0.048	0.135	A0A0R4IVH6.pdb.gz	A0A0R4IVH6_DANRE TCDD-inducible poly [ADP-ribose] polymerase OS=Danio rerio OX=7955 GN=fc03g05 PE=3 SV=1
10	AFDB:Q9H0J9	0.116	0.283	2.331E-22	701	0.058	0.148	Q9H0J9.pdb.gz	PAR12_HUMAN Protein mono-ADP-ribosyltransferase PARP12 OS=Homo sapiens OX=9606 GN=PARP12 PE=1 SV=1
11	PDB:5cb5R	0.090	0.901	7.671E-13	173	0.033	0.347	5cb5R.pdb.gz	Structural insights into the mechanism of Escherichia coli YmdB: A 2'-O-acetyl-ADP-ribose deacetylase
12	PDB:6fx7A	0.096	0.832	1.160E-12	194	0.032	0.294	6fx7A.pdb.gz	Crystal structure of in vitro evolved Af1521
13	PDB:6y4zA	0.090	0.697	3.514E-11	221	0.029	0.240	6y4zA.pdb.gz
14	PDB:6x0lP	0.076	0.271	1.913E-6	474	0.019	0.072	6x0lP.pdb.gz	Bridging of DNA breaks activates PARP2-HPF1 to modify chromatin.
15	PDB:1gytA	0.093	0.295	1.135E-4	503	0.026	0.091	1gytA.pdb.gz	X-Ray Structure of Aminopeptidase a from Escherichia Coli and a Model for the Nucleoprotein Complex in Xer Site-Specific Recombination
16	PDB:4ksiA	0.090	0.263	1.195E-4	517	0.029	0.101	4ksiA.pdb.gz	Structure of tomato wound-induced leucine aminopeptidase sheds light on substrate specificity.
17	PDB:5vsuA	0.053	0.176	2.004E-4	387	0.031	0.145	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
18	PDB:6lfqA	0.073	0.629	4.351E-4	169	0.014	0.148	6lfqA.pdb.gz
19	PDB:7oqcF	0.042	0.261	8.090E-4	267	0.018	0.124	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
20	PDB:2lgrA	0.066	0.650	1.048E-3	152	0.013	0.151	2lgrA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q2EMV9	0.0	2282	1817	0.638	0.632	PAR14_MOUSE Protein mono-ADP-ribosyltransferase PARP14 OS=Mus musculus OX=10090 GN=Parp14 PE=1 SV=3
2	Q460N5	0.0	3736	1801	1.000	1.000	PAR14_HUMAN Protein mono-ADP-ribosyltransferase PARP14 OS=Homo sapiens OX=9606 GN=PARP14 PE=1 SV=3
3	Q460N3	1.47e-122	404	678	0.116	0.308	PAR15_HUMAN Protein mono-ADP-ribosyltransferase PARP15 OS=Homo sapiens OX=9606 GN=PARP15 PE=1 SV=2
4	Q8IXQ6	1.81e-61	230	854	0.083	0.176	PARP9_HUMAN Protein mono-ADP-ribosyltransferase PARP9 OS=Homo sapiens OX=9606 GN=PARP9 PE=1 SV=2
5	Q8CAS9	1.95e-61	230	866	0.082	0.171	PARP9_MOUSE Protein mono-ADP-ribosyltransferase PARP9 OS=Mus musculus OX=10090 GN=Parp9 PE=1 SV=2
6	A0A0R4IVH6	2.10e-33	141	646	0.047	0.132	A0A0R4IVH6_DANRE TCDD-inducible poly [ADP-ribose] polymerase OS=Danio rerio OX=7955 GN=fc03g05 PE=3 SV=1
7	E9PK67	2.39e-33	143	1016	0.039	0.069	E9PK67_HUMAN Poly [ADP-ribose] polymerase OS=Homo sapiens OX=9606 GN=PARP10 PE=1 SV=1
8	Q53GL7	2.43e-33	143	1025	0.039	0.068	PAR10_HUMAN Protein mono-ADP-ribosyltransferase PARP10 OS=Homo sapiens OX=9606 GN=PARP10 PE=1 SV=2
9	E9PNI7	2.77e-33	143	1037	0.039	0.068	E9PNI7_HUMAN Poly [ADP-ribose] polymerase OS=Homo sapiens OX=9606 GN=PARP10 PE=1 SV=1
10	F1N973	1.67e-32	138	670	0.046	0.124	F1N973_CHICK TCDD inducible poly(ADP-ribose) polymerase OS=Gallus gallus OX=9031 GN=TIPARP PE=3 SV=2
11	Q9H0J9	2.33e-30	132	701	0.042	0.107	PAR12_HUMAN Protein mono-ADP-ribosyltransferase PARP12 OS=Homo sapiens OX=9606 GN=PARP12 PE=1 SV=1
12	A0A8I6GA83	4.54e-30	131	688	0.042	0.109	A0A8I6GA83_RAT TCDD-inducible poly(ADP-ribose) polymerase OS=Rattus norvegicus OX=10116 GN=Tiparp PE=3 SV=1
13	Q05BQ2	4.80e-30	130	660	0.042	0.114	Q05BQ2_HUMAN TIPARP protein (Fragment) OS=Homo sapiens OX=9606 GN=TIPARP PE=2 SV=1
14	Q8C1B2	5.38e-30	130	657	0.042	0.114	PARPT_MOUSE Protein mono-ADP-ribosyltransferase TIPARP OS=Mus musculus OX=10090 GN=Tiparp PE=2 SV=1
15	Q7Z3E1	5.72e-30	130	657	0.042	0.114	PARPT_HUMAN Protein mono-ADP-ribosyltransferase TIPARP OS=Homo sapiens OX=9606 GN=TIPARP PE=1 SV=1
16	D3ZMH5	5.82e-30	130	657	0.042	0.114	D3ZMH5_RAT TCDD-inducible poly(ADP-ribose) polymerase OS=Rattus norvegicus OX=10116 GN=Tiparp PE=3 SV=1
17	Q8CFF0	1.23e-27	118	331	0.042	0.230	PAR11_MOUSE Protein mono-ADP-ribosyltransferase PARP11 OS=Mus musculus OX=10090 GN=Parp11 PE=2 SV=1
18	Q9NR21	2.72e-27	117	338	0.042	0.222	PAR11_HUMAN Protein mono-ADP-ribosyltransferase PARP11 OS=Homo sapiens OX=9606 GN=PARP11 PE=1 SV=2
19	P0A8D6	1.05e-24	105	177	0.032	0.328	YMDB_ECOLI O-acetyl-ADP-ribose deacetylase OS=Escherichia coli (strain K12) OX=83333 GN=ymdB PE=1 SV=1
20	Q9BQ69	3.65e-16	84.0	325	0.030	0.166	MACD1_HUMAN ADP-ribose glycohydrolase MACROD1 OS=Homo sapiens OX=9606 GN=MACROD1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01661 Macro	2.6e-60	213.1	Macro domain
2	PF07292 NID	40	16.1	Nmi/IFP 35 domain (NID)
3	PF00644 PARP	8.6e-18	76.1	Poly(ADP-ribose) polymerase catalytic domain
4	PF00438 S-AdoMet_synt_N	1.3e+02	14.6	S-adenosylmethionine synthetase, N-terminal domain
5	PF14523 Syntaxin_2	4.1e+02	12.8	Syntaxin-like protein
6	PF02825 WWE	1.4	20.9	WWE domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000418194

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000300134	0.977	Signal transducer and activator of transcription 6
2	9606.ENSP00000296161	0.972	E3 ubiquitin-protein ligase DTX3L
3	9606.ENSP00000353512	0.967	Poly [ADP-ribose] polymerase 9
4	9606.ENSP00000263642	0.904	Interferon-induced helicase C domain-containing protein 1
5	9606.ENSP00000430432	0.881	Histone deacetylase 2
6	9606.ENSP00000464087	0.870	E3 ubiquitin-protein ligase RNF213
7	9606.ENSP00000371471	0.805	Radical S-adenosyl methionine domain-containing protein 2
8	9606.ENSP00000360883	0.785	Interferon-induced protein with tetratricopeptide repeats 3
9	9606.ENSP00000368699	0.768	Ubiquitin-like protein ISG15
10	9606.ENSP00000354394	0.763	Signal transducer and activator of transcription 1-alpha/beta
11	9606.ENSP00000261888	0.720	Mono [ADP-ribose] polymerase PARP16
12	9606.ENSP00000417401	0.706	Helicase with zinc finger domain 2
13	9606.ENSP00000428220	0.702	Immunity-related GTPase family M protein
14	9606.ENSP00000259030	0.688	Receptor-transporting protein 4
15	9606.ENSP00000381740	0.684	Poly [ADP-ribose] polymerase 3
16	9606.ENSP00000380697	0.681	Interferon regulatory factor 7
17	9606.ENSP00000355759	0.671	Poly [ADP-ribose] polymerase 1
18	9606.ENSP00000250416	0.667	Poly [ADP-ribose] polymerase 2
19	9606.ENSP00000251642	0.665	Probable ATP-dependent RNA helicase DHX58
20	9606.ENSP00000233057	0.664	Interferon-induced, double-stranded RNA-activated protein kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.998	heterocyclic compound binding
GO:0097159	0.998	organic cyclic compound binding
GO:1990404	0.997	NAD+-protein ADP-ribosyltransferase activity
GO:0043168	0.990	anion binding
GO:0003950	0.990	NAD+ ADP-ribosyltransferase activity
GO:0019899	0.979	enzyme binding
GO:0017076	0.968	purine nucleotide binding
GO:0051287	0.935	NAD binding
GO:0070403	0.934	NAD+ binding
GO:0003676	0.440	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0044238	0.993	primary metabolic process
GO:0006807	0.991	nitrogen compound metabolic process
GO:0080090	0.990	regulation of primary metabolic process
GO:0048584	0.989	positive regulation of response to stimulus
GO:0009966	0.989	regulation of signal transduction
GO:0043170	0.987	macromolecule metabolic process
GO:0031323	0.985	regulation of cellular metabolic process
GO:0045088	0.985	regulation of innate immune response
GO:0051171	0.981	regulation of nitrogen compound metabolic process
GO:1901564	0.975	organonitrogen compound metabolic process
GO:0001959	0.975	regulation of cytokine-mediated signaling pathway
GO:0010605	0.974	negative regulation of macromolecule metabolic process
GO:0048585	0.972	negative regulation of response to stimulus
GO:0060760	0.972	positive regulation of response to cytokine stimulus
GO:0051246	0.970	regulation of protein metabolic process
GO:0019538	0.970	protein metabolic process
GO:0010604	0.969	positive regulation of macromolecule metabolic process
GO:0048523	0.960	negative regulation of cellular process
GO:0036211	0.960	protein modification process
GO:0031325	0.957	positive regulation of cellular metabolic process
GO:0045824	0.957	negative regulation of innate immune response
GO:0060761	0.956	negative regulation of response to cytokine stimulus
GO:0001960	0.954	negative regulation of cytokine-mediated signaling pathway
GO:0051172	0.951	negative regulation of nitrogen compound metabolic process
GO:0031399	0.945	regulation of protein modification process
GO:0051173	0.941	positive regulation of nitrogen compound metabolic process
GO:0001961	0.938	positive regulation of cytokine-mediated signaling pathway
GO:0001932	0.911	regulation of protein phosphorylation
GO:0010468	0.892	regulation of gene expression
GO:0031324	0.856	negative regulation of cellular metabolic process
GO:0031400	0.845	negative regulation of protein modification process
GO:0042509	0.809	regulation of tyrosine phosphorylation of STAT protein
GO:1904892	0.751	regulation of receptor signaling pathway via STAT
GO:0045936	0.733	negative regulation of phosphate metabolic process
GO:0050732	0.692	negative regulation of peptidyl-tyrosine phosphorylation
GO:1904893	0.652	negative regulation of receptor signaling pathway via STAT
GO:0045937	0.621	positive regulation of phosphate metabolic process
GO:0009987	0.619	cellular process
GO:0051247	0.618	positive regulation of protein metabolic process
GO:0046425	0.610	regulation of receptor signaling pathway via JAK-STAT
GO:0050731	0.571	positive regulation of peptidyl-tyrosine phosphorylation
GO:0043687	0.535	post-translational protein modification
GO:0050896	0.425	response to stimulus
GO:0042531	0.374	positive regulation of tyrosine phosphorylation of STAT protein
GO:0046426	0.343	negative regulation of receptor signaling pathway via JAK-STAT
GO:0010629	0.327	negative regulation of gene expression
GO:0051716	0.308	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0016020	0.996	membrane
GO:0005886	0.983	plasma membrane
GO:0031981	0.496	nuclear lumen
GO:0005654	0.470	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.2.-	0.998	Pentosyltransferases.
EC:2.4.2.30	0.990	NAD(+) ADP-ribosyltransferase.

[back to server]