StarFunc result for job id Q494U1

User Input

>input (611 residues)
MGNSHCVPQAPRRLRASFSRKPSLKGNREDSARMSAGLPGPEAARSGDAAANKLFHYIPG
TDILDLENQRENLEQPFLSVFKKGRRRVPVRNLGKVVHYAKVQLRFQHSQDVSDCYLELF
PAHLYFQAHGSEGLTFQGLLPLTELSVCPLEGSREHAFQITGPLPAPLLVLCPSRAELDR
WLYHLEKQTALLGGPRRCHSAPPQRRLTRLRTASGHEPGGSAVCASRVKLQHLPAQEQWD
RLLVLYPTSLAIFSEELDGLCFKGELPLRAVHINLEEKEKQIRSFLIEGPLINTIRVVCA
SYEDYGHWLLCLRAVTHREGAPPLPGAESFPGSQVMGSGRGSLSSGGQTSWDSGCLAPPS
TRTSHSLPESSVPSTVGCSSQHTPDQANSDRASIGRRRTELRRSGSSRSPGSKARAEGRG
PVTPLHLDLTQLHRLSLESSPDAPDHTSETSHSPLYADPYTPPATSHRRVTDVRGLEEFL
SAMQSARGPTPSSPLPSVPVSVPASDPRSCSSGPAGPYLLSKKGALQSRAAQRHRGSAKD
GGPQPPDAPQLVSSAREGSPEPWLPLTDGRSPRRSRDPGYDHLWDETLSSSHQKCPQLGG
PEASGGLVQWI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q494U1	0.999	0.999	2.190E-93	611	1.000	1.000	Q494U1.pdb.gz	PKHN1_HUMAN Pleckstrin homology domain-containing family N member 1 OS=Homo sapiens OX=9606 GN=PLEKHN1 PE=1 SV=3
2	AFDB:Q8C886	0.364	0.365	2.502E-61	610	0.664	0.666	Q8C886.pdb.gz	PKHN1_MOUSE Probable pleckstrin homology domain-containing family N member 1 OS=Mus musculus OX=10090 GN=Plekhn1 PE=1 SV=2
3	PDB:3ljuX	0.199	0.292	1.418E-9	373	0.056	0.091	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
4	AFDB:Q9DF49	0.170	0.106	8.675E-9	1074	0.152	0.087	Q9DF49.pdb.gz	IRS2A_XENLA Insulin receptor substrate 2-A OS=Xenopus laevis OX=8355 GN=irs2-a PE=2 SV=2
5	AFDB:F1MAL5	0.164	0.085	1.181E-7	1327	0.172	0.079	F1MAL5.pdb.gz	F1MAL5_RAT Insulin receptor substrate 2 OS=Rattus norvegicus OX=10116 GN=Irs2 PE=1 SV=2
6	AFDB:P35568	0.148	0.083	1.550E-7	1242	0.162	0.080	P35568.pdb.gz	IRS1_HUMAN Insulin receptor substrate 1 OS=Homo sapiens OX=9606 GN=IRS1 PE=1 SV=1
7	AFDB:F1QHL0	0.185	0.122	1.825E-7	1032	0.144	0.085	F1QHL0.pdb.gz
8	AFDB:Q9Y4H2	0.158	0.082	5.416E-7	1338	0.172	0.078	Q9Y4H2.pdb.gz	IRS2_HUMAN Insulin receptor substrate 2 OS=Homo sapiens OX=9606 GN=IRS2 PE=1 SV=2
9	AFDB:E7F4P8	0.150	0.093	6.376E-7	1099	0.139	0.077	E7F4P8.pdb.gz	E7F4P8_DANRE Insulin receptor substrate 1 OS=Danio rerio OX=7955 GN=irs1 PE=4 SV=1
10	PDB:7c3mA	0.130	0.137	9.185E-7	577	0.052	0.055	7c3mA.pdb.gz
11	PDB:4mt6A	0.164	0.250	3.209E-6	389	0.034	0.054	4mt6A.pdb.gz
12	AFDB:Q9XTN2	0.169	0.117	6.982E-6	968	0.095	0.060	Q9XTN2.pdb.gz	IRS1_DROME Insulin receptor substrate 1 OS=Drosophila melanogaster OX=7227 GN=chico PE=1 SV=1
13	PDB:7nkyQ	0.167	0.225	1.184E-5	404	0.047	0.072	7nkyQ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
14	PDB:6upkH	0.180	0.245	2.985E-5	411	0.057	0.085	6upkH.pdb.gz	FACT caught in the act of manipulating the nucleosome.
15	PDB:4mk0A	0.152	0.147	6.394E-5	631	0.039	0.038	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
16	AFDB:Q9QYY0	0.149	0.133	1.638E-4	695	0.131	0.115	Q9QYY0.pdb.gz	GAB1_MOUSE GRB2-associated-binding protein 1 OS=Mus musculus OX=10090 GN=Gab1 PE=1 SV=2
17	PDB:6xtbE	0.118	0.261	2.777E-4	235	0.029	0.077	6xtbE.pdb.gz
18	PDB:6hhgA	0.167	0.247	2.932E-4	386	0.039	0.062	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
19	PDB:7nkyO	0.173	0.225	2.932E-4	427	0.065	0.094	7nkyO.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
20	PDB:3uzsA	0.147	0.148	3.096E-4	609	0.039	0.039	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q494U1	0.0	1227	611	1.000	1.000	PKHN1_HUMAN Pleckstrin homology domain-containing family N member 1 OS=Homo sapiens OX=9606 GN=PLEKHN1 PE=1 SV=3
2	Q8C886	0.0	727	610	0.656	0.657	PKHN1_MOUSE Probable pleckstrin homology domain-containing family N member 1 OS=Mus musculus OX=10090 GN=Plekhn1 PE=1 SV=2
3	Q14155	6.54e-12	70.9	803	0.072	0.055	ARHG7_HUMAN Rho guanine nucleotide exchange factor 7 OS=Homo sapiens OX=9606 GN=ARHGEF7 PE=1 SV=2
4	F1QA07	2.97e-10	65.5	643	0.070	0.067	F1QA07_DANRE Rho guanine nucleotide exchange factor (GEF) 7b OS=Danio rerio OX=7955 GN=arhgef7 PE=1 SV=1
5	Q5PRA8	3.00e-10	65.9	799	0.070	0.054	Q5PRA8_DANRE Arhgef7b protein OS=Danio rerio OX=7955 GN=arhgef7 PE=1 SV=1
6	Q9ES28	1.19e-07	57.4	862	0.065	0.046	ARHG7_MOUSE Rho guanine nucleotide exchange factor 7 OS=Mus musculus OX=10090 GN=Arhgef7 PE=1 SV=2
7	O55043	7.99e-07	54.7	646	0.056	0.053	ARHG7_RAT Rho guanine nucleotide exchange factor 7 OS=Rattus norvegicus OX=10116 GN=Arhgef7 PE=1 SV=1
8	A8DZ20	3.90e-06	52.4	973	0.061	0.038	A8DZ20_DROME Rho-type guanine nucleotide exchange factor, isoform D OS=Drosophila melanogaster OX=7227 GN=RtGEF PE=1 SV=2
9	M9PGB1	4.12e-06	52.4	923	0.061	0.040	M9PGB1_DROME Rho-type guanine nucleotide exchange factor, isoform G OS=Drosophila melanogaster OX=7227 GN=RtGEF PE=1 SV=1
10	C3KGL5	4.22e-06	52.4	635	0.061	0.058	C3KGL5_DROME GH28580p OS=Drosophila melanogaster OX=7227 GN=RtGEF PE=1 SV=1
11	Q8SYV1	4.25e-06	52.4	687	0.061	0.054	Q8SYV1_DROME RE32772p OS=Drosophila melanogaster OX=7227 GN=RtGEF PE=2 SV=1
12	Q9VIN1	4.25e-06	52.4	687	0.061	0.054	Q9VIN1_DROME Rho-type guanine nucleotide exchange factor, isoform A OS=Drosophila melanogaster OX=7227 GN=RtGEF PE=1 SV=1
13	O62527	3.07e-05	49.3	687	0.059	0.052	O62527_DROME Rho type GEF OS=Drosophila melanogaster OX=7227 GN=RtGEF PE=2 SV=1
14	A8DZ19	3.28e-05	49.7	1310	0.052	0.024	A8DZ19_DROME Rho-type guanine nucleotide exchange factor, isoform F OS=Drosophila melanogaster OX=7227 GN=RtGEF PE=1 SV=2
15	Q8K4I3	6.03e-05	48.5	771	0.044	0.035	ARHG6_MOUSE Rho guanine nucleotide exchange factor 6 OS=Mus musculus OX=10090 GN=Arhgef6 PE=1 SV=1
16	M9PBE8	6.19e-05	48.5	1198	0.052	0.027	M9PBE8_DROME Rho-type guanine nucleotide exchange factor, isoform H OS=Drosophila melanogaster OX=7227 GN=RtGEF PE=1 SV=1
17	Q15052	2.19e-04	46.6	776	0.043	0.034	ARHG6_HUMAN Rho guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 GN=ARHGEF6 PE=1 SV=2
18	Q9VIF1	0.41	36.2	625	0.028	0.027	MUT7_DROME Exonuclease mut-7 homolog OS=Drosophila melanogaster OX=7227 GN=Nbr PE=1 SV=1
19	Q9VC66	1.3	34.3	406	0.056	0.084	Q9VC66_DROME Protein phosphatase 1 regulatory subunit 21 OS=Drosophila melanogaster OX=7227 GN=Dmel\CG6607 PE=1 SV=1
20	Q9I0F4	5.2	32.7	1317	0.057	0.027	TSE5_PSEAE Toxin protein Tse5 OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=tse5 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00169 PH	0.0041	28.9	PH domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368720

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000342313	0.809	Sterile alpha motif domain-containing protein 11
2	9606.ENSP00000343930	0.657	Kelch-like protein 17
3	9606.ENSP00000368318	0.631	Pseudouridylate synthase-like 1
4	9606.ENSP00000382030	0.629	RAD51 associated protein 2
5	9606.ENSP00000414022	0.624	PGC-1 and ERR-induced regulator in muscle protein 1
6	9606.ENSP00000309606	0.609	Zinc finger protein 408
7	9606.ENSP00000367890	0.571	NAD kinase
8	9606.ENSP00000304643	0.566	Calmodulin-like protein 6
9	9606.ENSP00000362332	0.553	Transcription factor AP-2-epsilon
10	9606.ENSP00000368411	0.532	Amiloride-sensitive sodium channel subunit delta
11	9606.ENSP00000417185	0.532	Von Willebrand factor A domain-containing protein 1
12	9606.ENSP00000373937	0.505	Protogenin
13	9606.ENSP00000368592	0.503	Inactive polyglycylase TTLL10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901981	0.990	phosphatidylinositol phosphate binding
GO:0070300	0.989	phosphatidic acid binding
GO:0001786	0.988	phosphatidylserine binding
GO:1901612	0.988	cardiolipin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0050794	0.992	regulation of cellular process
GO:0010468	0.981	regulation of gene expression
GO:0010558	0.981	negative regulation of macromolecule biosynthetic process
GO:0031327	0.980	negative regulation of cellular biosynthetic process
GO:0051246	0.979	regulation of protein metabolic process
GO:0051252	0.979	regulation of RNA metabolic process
GO:0009894	0.968	regulation of catabolic process
GO:0006417	0.966	regulation of translation
GO:0065008	0.965	regulation of biological quality
GO:2000113	0.965	negative regulation of cellular macromolecule biosynthetic process
GO:1903311	0.964	regulation of mRNA metabolic process
GO:0051172	0.960	negative regulation of nitrogen compound metabolic process
GO:0048518	0.949	positive regulation of biological process
GO:0009893	0.936	positive regulation of metabolic process
GO:0048522	0.930	positive regulation of cellular process
GO:0017148	0.918	negative regulation of translation
GO:0010604	0.909	positive regulation of macromolecule metabolic process
GO:0061013	0.909	regulation of mRNA catabolic process
GO:0031325	0.904	positive regulation of cellular metabolic process
GO:0043487	0.898	regulation of RNA stability
GO:0051173	0.875	positive regulation of nitrogen compound metabolic process
GO:0051254	0.867	positive regulation of RNA metabolic process
GO:0031331	0.866	positive regulation of cellular catabolic process
GO:0043488	0.848	regulation of mRNA stability
GO:1903313	0.828	positive regulation of mRNA metabolic process
GO:0061157	0.751	mRNA destabilization
GO:0050896	0.672	response to stimulus
GO:0009987	0.448	cellular process
GO:0010941	0.323	regulation of cell death
GO:0042981	0.307	regulation of apoptotic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0016020	0.997	membrane
GO:0043232	0.996	intracellular non-membrane-bounded organelle
GO:0031090	0.902	organelle membrane
GO:0031975	0.886	envelope
GO:0005856	0.859	cytoskeleton
GO:0031967	0.804	organelle envelope
GO:0031966	0.615	mitochondrial membrane
GO:0005634	0.375	nucleus
GO:0043233	0.374	organelle lumen
GO:0070013	0.323	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]