StarFunc result for job id Q494W8

User Input

>input (412 residues)
MQKYCIYQHFQFQLLIQHLWIAANCDIADERFDATFHTNVLVNSSGHCQYLPPGIFKSSC
YIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQEADISGYIPNGEWDLVGIPGKRSERFY
ECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLL
SLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKW
TRVILLNWCAWFLRMKRPGEDKVRPACQHKQRRCSLASVEMSAVAPPPASNGNLLYIGFR
GLDGVHCVPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRFRCQ
DESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPNFVEAVSKDFA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P36544	0.762	0.636	7.519E-57	502	0.937	0.769	P36544.pdb.gz	ACHA7_HUMAN Neuronal acetylcholine receptor subunit alpha-7 OS=Homo sapiens OX=9606 GN=CHRNA7 PE=1 SV=5
2	AFDB:F1P4Y5	0.718	0.597	1.277E-52	502	0.857	0.703	F1P4Y5.pdb.gz
3	AFDB:A0A0R4IV47	0.716	0.588	3.061E-48	510	0.735	0.594	A0A0R4IV47.pdb.gz
4	AFDB:Q03481	0.711	0.581	8.312E-45	511	0.655	0.528	Q03481.pdb.gz	Q03481_CHICK Alpha8 subunit of nicotinic acetylcholine receptor OS=Gallus gallus OX=9031 GN=CHRNA8 PE=2 SV=1
5	AFDB:E1JJR2	0.692	0.512	1.647E-33	564	0.454	0.332	E1JJR2.pdb.gz	E1JJR2_DROME Nicotinic acetylcholine receptor alpha7, isoform E OS=Drosophila melanogaster OX=7227 GN=nAChRalpha7 PE=3 SV=1
6	AFDB:Q7KT97	0.693	0.362	1.080E-31	808	0.454	0.231	Q7KT97.pdb.gz	Q7KT97_DROME Nicotinic acetylcholine receptor alpha5, isoform B OS=Drosophila melanogaster OX=7227 GN=nAChRalpha5 PE=3 SV=1
7	AFDB:Q15822	0.675	0.535	3.359E-30	529	0.376	0.293	Q15822.pdb.gz	ACHA2_HUMAN Neuronal acetylcholine receptor subunit alpha-2 OS=Homo sapiens OX=9606 GN=CHRNA2 PE=1 SV=2
8	AFDB:Q7KTF8	0.689	0.549	4.225E-30	523	0.420	0.331	Q7KTF8.pdb.gz	Q7KTF8_DROME Nicotinic acetylcholine receptor alpha6, isoform E OS=Drosophila melanogaster OX=7227 GN=nAChRalpha6 PE=3 SV=1
9	AFDB:B3DGY1	0.671	0.540	9.978E-30	520	0.347	0.275	B3DGY1.pdb.gz
10	AFDB:Q91X60	0.666	0.544	5.566E-29	512	0.362	0.291	Q91X60.pdb.gz	ACHA2_MOUSE Neuronal acetylcholine receptor subunit alpha-2 OS=Mus musculus OX=10090 GN=Chrna2 PE=2 SV=1
11	PDB:6i53B	0.375	0.450	4.913E-10	338	0.109	0.133	6i53B.pdb.gz	Cryo-EM structure of the human alpha 1 beta 3 gamma 2 GABAAreceptor in a lipid bilayer.
12	PDB:4aq5E	0.422	0.464	7.686E-9	370	0.197	0.219	4aq5E.pdb.gz
13	PDB:6i53A	0.364	0.423	1.287E-8	349	0.083	0.097	6i53A.pdb.gz	Cryo-EM structure of the human alpha 1 beta 3 gamma 2 GABAAreceptor in a lipid bilayer.
14	PDB:7l6qA	0.349	0.447	1.619E-8	311	0.100	0.132	7l6qA.pdb.gz	Structure and function at the lipid-protein interface of a pentameric ligand-gated ion channel.
15	PDB:7kuyE	0.362	0.435	1.922E-8	338	0.114	0.139	7kuyE.pdb.gz	Characterization of the subunit composition and structure of adult human glycine receptors
16	PDB:4hfcA	0.360	0.466	1.124E-6	311	0.070	0.093	4hfcA.pdb.gz	Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
17	PDB:6zgdA	0.365	0.499	4.444E-6	288	0.097	0.139	6zgdA.pdb.gz
18	PDB:2w8gC	0.222	0.409	3.702E-5	217	0.075	0.143	2w8gC.pdb.gz	Use of Acetylcholine Binding Protein in the Search for Novel Alpha7 Nicotinic Receptor Ligands. In Silico Docking, Pharmacological Screening, and X- Ray Analysis.
19	PDB:4afhA	0.211	0.398	1.368E-3	213	0.058	0.113	4afhA.pdb.gz	Molecular Actions of Smoking Cessation Drugs at Alpha4Beta2 Nicotinic Receptors Defined in Crystal Structures of a Homologous Binding Protein.
20	PDB:7kgbR	0.077	0.253	5.609E-1	100	0.032	0.130	7kgbR.pdb.gz	Discovery of natural-product-derived sequanamycins as potent oral anti-tuberculosis agents.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P22770	0.0	743	502	0.857	0.703	ACHA7_CHICK Neuronal acetylcholine receptor subunit alpha-7 OS=Gallus gallus OX=9031 GN=CHRNA7 PE=1 SV=1
2	P36544	0.0	801	502	0.934	0.767	ACHA7_HUMAN Neuronal acetylcholine receptor subunit alpha-7 OS=Homo sapiens OX=9606 GN=CHRNA7 PE=1 SV=5
3	P49582	0.0	758	502	0.874	0.717	ACHA7_MOUSE Neuronal acetylcholine receptor subunit alpha-7 OS=Mus musculus OX=10090 GN=Chrna7 PE=1 SV=1
4	Q03481	0.0	538	511	0.655	0.528	Q03481_CHICK Alpha8 subunit of nicotinic acetylcholine receptor OS=Gallus gallus OX=9031 GN=CHRNA8 PE=2 SV=1
5	Q05941	0.0	758	502	0.874	0.717	ACHA7_RAT Neuronal acetylcholine receptor subunit alpha-7 OS=Rattus norvegicus OX=10116 GN=Chrna7 PE=1 SV=2
6	Q800C7	0.0	637	509	0.740	0.599	Q800C7_DANRE Neuronal acetylcholine receptor subunit alpha-7 OS=Danio rerio OX=7955 GN=chrna7 PE=2 SV=1
7	Q866A2	0.0	795	502	0.925	0.759	ACHA7_MACMU Neuronal acetylcholine receptor subunit alpha-7 OS=Macaca mulatta OX=9544 GN=CHRNA7 PE=2 SV=1
8	Q86MN7	1.13e-122	368	542	0.461	0.351	Q86MN7_DROME Nicotinic acetylcholine receptor subunit Dalpha7 OS=Drosophila melanogaster OX=7227 GN=nAChRalpha7 PE=2 SV=1
9	E1JJR2	1.05e-121	366	564	0.459	0.335	E1JJR2_DROME Nicotinic acetylcholine receptor alpha7, isoform E OS=Drosophila melanogaster OX=7227 GN=nAChRalpha7 PE=3 SV=1
10	Q9VWI9	1.37e-121	365	560	0.459	0.338	Q9VWI9_DROME Nicotinic acetylcholine receptor alpha7, isoform A OS=Drosophila melanogaster OX=7227 GN=nAChRalpha7 PE=3 SV=4
11	Q7KT97	2.70e-119	367	808	0.459	0.234	Q7KT97_DROME Nicotinic acetylcholine receptor alpha5, isoform B OS=Drosophila melanogaster OX=7227 GN=nAChRalpha5 PE=3 SV=1
12	Q8T7V5	1.43e-118	365	807	0.456	0.233	Q8T7V5_DROME Nicotinic acetylcholine receptor Dalpha5 subunit OS=Drosophila melanogaster OX=7227 GN=nAChRalpha5 PE=2 SV=1
13	Q7KTF9	3.63e-113	342	494	0.442	0.368	Q7KTF9_DROME Nicotinic acetylcholine receptor alpha6, isoform B OS=Drosophila melanogaster OX=7227 GN=nAChRalpha6 PE=3 SV=1
14	M9PFD8	4.04e-113	342	494	0.442	0.368	M9PFD8_DROME Nicotinic acetylcholine receptor alpha6, isoform H OS=Drosophila melanogaster OX=7227 GN=nAChRalpha6 PE=3 SV=1
15	Q8T7S2	1.84e-112	340	494	0.439	0.366	Q8T7S2_DROME Nicotinic acetylcholine receptor Dalpha6 subunit variant type II OS=Drosophila melanogaster OX=7227 GN=nAChRalpha6 PE=2 SV=1
16	Q86MN8	1.22e-111	338	494	0.439	0.366	Q86MN8_DROME Nicotinic acetylcholine receptor subunit Dalpha6 OS=Drosophila melanogaster OX=7227 GN=nAChRalpha6 PE=2 SV=1
17	Q8IPE2	1.90e-111	337	494	0.432	0.360	Q8IPE2_DROME Nicotinic acetylcholine receptor alpha6, isoform C OS=Drosophila melanogaster OX=7227 GN=nAChRalpha6 PE=3 SV=2
18	Q8T7S1	2.07e-111	337	494	0.432	0.360	Q8T7S1_DROME Nicotinic acetylcholine receptor Dalpha6 subunit variant type III OS=Drosophila melanogaster OX=7227 GN=nAChRalpha6 PE=2 SV=1
19	Q9VL79	2.12e-111	337	494	0.432	0.360	Q9VL79_DROME Nicotinic acetylcholine receptor Dalpha6 subunit variant type I OS=Drosophila melanogaster OX=7227 GN=nAChRalpha6 PE=2 SV=3
20	Q8T7S0	2.32e-111	338	509	0.432	0.350	Q8T7S0_DROME Nicotinic acetylcholine receptor Dalpha6 subunit variant type IV OS=Drosophila melanogaster OX=7227 GN=nAChRalpha6 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02931 Neur_chan_LBD	3e-29	113.5	Neurotransmitter-gated ion-channel ligand binding domain
2	PF02932 Neur_chan_memb	4.1e-59	212.1	Neurotransmitter-gated ion-channel transmembrane region
3	PF06687 SUR7	1.7e+02	13.2	SUR7/PalI family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000299847

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000305926	0.830	OTU domain-containing protein 7A
2	9606.ENSP00000357461	0.725	Neuronal acetylcholine receptor subunit beta-2
3	9606.ENSP00000261751	0.701	Neuronal acetylcholine receptor subunit beta-4
4	9606.ENSP00000402537	0.679	Myotubularin-related protein 10
5	9606.ENSP00000385026	0.666	Neuronal acetylcholine receptor subunit alpha-2
6	9606.ENSP00000315602	0.661	Neuronal acetylcholine receptor subunit alpha-3
7	9606.ENSP00000359285	0.661	Neuronal acetylcholine receptor subunit alpha-4
8	9606.ENSP00000321826	0.660	Syntaxin-binding protein 5
9	9606.ENSP00000407546	0.654	Neuronal acetylcholine receptor subunit alpha-7
10	9606.ENSP00000436785	0.654	Solute carrier family 35 member F2
11	9606.ENSP00000479365	0.654	Heterogeneous nuclear ribonucleoprotein C-like 1
12	9606.ENSP00000276410	0.652	Neuronal acetylcholine receptor subunit alpha-6
13	9606.ENSP00000371067	0.649	Tyrosine-protein kinase JAK2
14	9606.ENSP00000299565	0.642	Neuronal acetylcholine receptor subunit alpha-5
15	9606.ENSP00000312663	0.632	Neuronal acetylcholine receptor subunit alpha-9
16	9606.ENSP00000289957	0.624	Neuronal acetylcholine receptor subunit beta-3
17	9606.ENSP00000258385	0.621	Acetylcholine receptor subunit delta
18	9606.ENSP00000293780	0.619	Acetylcholine receptor subunit epsilon
19	9606.ENSP00000304290	0.619	Acetylcholine receptor subunit beta
20	9606.ENSP00000374145	0.619	Acetylcholine receptor subunit gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004888	0.997	transmembrane signaling receptor activity
GO:0022848	0.995	acetylcholine-gated monoatomic cation-selective channel activity
GO:0015464	0.990	acetylcholine receptor activity
GO:0005488	0.959	binding
GO:0005515	0.941	protein binding
GO:0043169	0.686	cation binding
GO:0015318	0.652	inorganic molecular entity transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.989	response to stimulus
GO:0065007	0.933	biological regulation
GO:0042221	0.922	response to chemical
GO:0035094	0.764	response to nicotine
GO:0009987	0.762	cellular process
GO:0050789	0.666	regulation of biological process
GO:0050794	0.606	regulation of cellular process
GO:0032501	0.546	multicellular organismal process
GO:0007154	0.536	cell communication
GO:0023052	0.531	signaling
GO:0003008	0.390	system process
GO:0051716	0.342	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043235	0.995	receptor complex
GO:0098796	0.995	membrane protein complex
GO:0005892	0.994	acetylcholine-gated channel complex
GO:0043226	0.747	organelle
GO:0030054	0.476	cell junction
GO:0045202	0.372	synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]