StarFunc result for job id Q495A1

User Input

>input (244 residues)
MRWCLLLIWAQGLRQAPLASGMMTGTIETTGNISAEKGGSIILQCHLSSTTAQVTQVNWE
QQDQLLAICNADLGWHISPSFKDRVAPGPGLGLTLQSLTVNDTGEYFCIYHTYPDGTYTG
RIFLEVLESSVAEHGARFQIPLLGAMAATLVVICTAVIVVVALTRKKKALRIHSVEGDLR
RKSAGQEEWSPSAPSPPGSCVQAEAAPAGLCGEQRGEDCAELHDYFNVLSYRSLGNCSFF
TETG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q495A1	1.000	1.000	4.555E-41	244	1.000	1.000	Q495A1.pdb.gz	TIGIT_HUMAN T-cell immunoreceptor with Ig and ITIM domains OS=Homo sapiens OX=9606 GN=TIGIT PE=1 SV=1
2	AFDB:P86176	0.504	0.495	1.032E-23	249	0.590	0.578	P86176.pdb.gz	TIGIT_MOUSE T-cell immunoreceptor with Ig and ITIM domains OS=Mus musculus OX=10090 GN=Tigit PE=3 SV=1
3	AFDB:Q9D806	0.406	0.490	2.446E-10	199	0.127	0.156	Q9D806.pdb.gz	VSTM5_MOUSE V-set and transmembrane domain-containing protein 5 OS=Mus musculus OX=10090 GN=Vstm5 PE=1 SV=1
4	AFDB:Q15762	0.434	0.338	2.735E-10	336	0.172	0.125	Q15762.pdb.gz	CD226_HUMAN CD226 antigen OS=Homo sapiens OX=9606 GN=CD226 PE=1 SV=2
5	AFDB:O60939	0.364	0.409	3.420E-10	215	0.164	0.186	O60939.pdb.gz	SCN2B_HUMAN Sodium channel subunit beta-2 OS=Homo sapiens OX=9606 GN=SCN2B PE=1 SV=1
6	AFDB:Q15223	0.426	0.208	5.058E-10	517	0.127	0.060	Q15223.pdb.gz	NECT1_HUMAN Nectin-1 OS=Homo sapiens OX=9606 GN=NECTIN1 PE=1 SV=3
7	AFDB:O95297	0.406	0.371	6.325E-10	269	0.172	0.156	O95297.pdb.gz	MPZL1_HUMAN Myelin protein zero-like protein 1 OS=Homo sapiens OX=9606 GN=MPZL1 PE=1 SV=1
8	AFDB:Q92692	0.417	0.196	6.689E-10	538	0.152	0.069	Q92692.pdb.gz	NECT2_HUMAN Nectin-2 OS=Homo sapiens OX=9606 GN=NECTIN2 PE=1 SV=1
9	AFDB:F6TUL9	0.393	0.347	7.073E-10	280	0.135	0.118	F6TUL9.pdb.gz	F6TUL9_MOUSE V-set and immunoglobulin domain containing 4 OS=Mus musculus OX=10090 GN=Vsig4 PE=1 SV=1
10	AFDB:Q7M729	0.376	0.400	7.073E-10	228	0.189	0.202	Q7M729.pdb.gz	SCN4B_MOUSE Sodium channel subunit beta-4 OS=Mus musculus OX=10090 GN=Scn4b PE=1 SV=1
11	PDB:3oaiA	0.364	0.188	2.970E-7	488	0.082	0.041	3oaiA.pdb.gz	Crystal structure of the extracellular domain of human myelin protein zero.
12	PDB:5c6wJ	0.356	0.365	8.122E-7	238	0.098	0.101	5c6wJ.pdb.gz
13	PDB:5ir3A	0.329	0.681	1.136E-6	111	0.082	0.180	5ir3A.pdb.gz
14	PDB:6hd8A	0.365	0.202	2.778E-6	461	0.090	0.048	6hd8A.pdb.gz	Structural basis for ion selectivity in TMEM175 K+channels.
15	PDB:1cd0A	0.334	0.694	3.106E-6	111	0.094	0.207	1cd0A.pdb.gz
16	PDB:1ngwH	0.353	0.395	3.106E-6	216	0.090	0.102	1ngwH.pdb.gz	Structural evidence for substrate strain in antibody catalysis
17	PDB:1ezvX	0.339	0.601	3.884E-6	127	0.102	0.197	1ezvX.pdb.gz	Structure at 2.3 A resolution of the cytochrome bc(1) complex from the yeast Saccharomyces cerevisiae co-crystallized with an antibody Fv fragment.
18	PDB:1ohqA	0.376	0.716	4.593E-6	120	0.086	0.175	1ohqA.pdb.gz
19	PDB:6dlfA	0.313	0.323	4.593E-6	236	0.107	0.110	6dlfA.pdb.gz
20	PDB:3zhlA	0.364	0.677	6.074E-6	121	0.107	0.215	3zhlA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q495A1	0.0	505	244	1.000	1.000	TIGIT_HUMAN T-cell immunoreceptor with Ig and ITIM domains OS=Homo sapiens OX=9606 GN=TIGIT PE=1 SV=1
2	P86176	8.37e-95	280	249	0.598	0.586	TIGIT_MOUSE T-cell immunoreceptor with Ig and ITIM domains OS=Mus musculus OX=10090 GN=Tigit PE=3 SV=1
3	K4PZ75	5.35e-07	52.4	510	0.156	0.075	K4PZ75_HUMAN Ig superfamily receptor LNIR OS=Homo sapiens OX=9606 GN=LNIR PE=2 SV=1
4	Q96NY8	5.35e-07	52.4	510	0.156	0.075	NECT4_HUMAN Nectin-4 OS=Homo sapiens OX=9606 GN=NECTIN4 PE=1 SV=1
5	A0A8I5ZLI7	2.63e-05	47.0	447	0.131	0.072	A0A8I5ZLI7_RAT Nectin cell adhesion molecule 1 OS=Rattus norvegicus OX=10116 GN=Nectin1 PE=1 SV=1
6	F1LNP8	4.11e-05	46.6	515	0.131	0.062	F1LNP8_RAT Nectin cell adhesion molecule 1 OS=Rattus norvegicus OX=10116 GN=Nectin1 PE=1 SV=2
7	B0CLW6	4.26e-05	46.2	328	0.152	0.113	B0CLW6_DANRE PVR cell adhesion molecule related 2 like precursor OS=Danio rerio OX=7955 GN=si:dkey-225e11.1 PE=1 SV=1
8	P32507	5.16e-05	46.2	530	0.143	0.066	NECT2_MOUSE Nectin-2 OS=Mus musculus OX=10090 GN=Nectin2 PE=1 SV=2
9	Q9JKF6	1.62e-04	44.7	515	0.123	0.058	NECT1_MOUSE Nectin-1 OS=Mus musculus OX=10090 GN=Nectin1 PE=1 SV=3
10	Q15223	0.001	42.4	517	0.115	0.054	NECT1_HUMAN Nectin-1 OS=Homo sapiens OX=9606 GN=NECTIN1 PE=1 SV=3
11	Q9GL76	0.002	41.2	515	0.119	0.056	NECT1_PIG Nectin-1 OS=Sus scrofa OX=9823 GN=NECTIN1 PE=1 SV=1
12	Q8BVF6	0.012	38.9	408	0.123	0.074	Q8BVF6_MOUSE Ig-like domain-containing protein OS=Mus musculus OX=10090 GN=Pvr PE=2 SV=1
13	Q8K094	0.012	38.9	408	0.123	0.074	Q8K094_MOUSE Poliovirus receptor OS=Mus musculus OX=10090 GN=Pvr PE=1 SV=1
14	Q91WP1	0.012	38.9	408	0.123	0.074	Q91WP1_MOUSE Cd155 OS=Mus musculus OX=10090 GN=Pvr PE=2 SV=1
15	Q92692	0.012	38.9	538	0.135	0.061	NECT2_HUMAN Nectin-2 OS=Homo sapiens OX=9606 GN=NECTIN2 PE=1 SV=1
16	Q9JLB9	0.013	38.9	549	0.115	0.051	NECT3_MOUSE Nectin-3 OS=Mus musculus OX=10090 GN=Nectin3 PE=1 SV=1
17	A0A8I6APZ5	0.016	38.5	438	0.111	0.062	A0A8I6APZ5_RAT Nectin cell adhesion molecule 3 OS=Rattus norvegicus OX=10116 GN=Nectin3 PE=3 SV=1
18	Q56A07	0.017	37.7	215	0.102	0.116	SCN2B_MOUSE Sodium channel subunit beta-2 OS=Mus musculus OX=10090 GN=Scn2b PE=1 SV=1
19	P54900	0.019	37.7	215	0.102	0.116	SCN2B_RAT Sodium channel subunit beta-2 OS=Rattus norvegicus OX=10116 GN=Scn2b PE=1 SV=1
20	D4A5C0	0.020	38.1	528	0.111	0.051	D4A5C0_RAT Nectin cell adhesion molecule 3 OS=Rattus norvegicus OX=10116 GN=Nectin3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	22	16.5	Immunoglobulin I-set domain
2	PF00047 ig	0.0047	28.4	Immunoglobulin domain
3	PF13895 Ig_2	1.5	20.5	Immunoglobulin domain
4	PF13927 Ig_3	0.48	22.3	Immunoglobulin domain
5	PF07686 V-set	4.7e-05	34.9	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000419085

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000252483	0.999	Nectin-2
2	9606.ENSP00000402060	0.999	Poliovirus receptor
3	9606.ENSP00000280200	0.971	CD226 antigen
4	9606.ENSP00000418070	0.969	Nectin-3
5	9606.ENSP00000405338	0.963	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1
6	9606.ENSP00000283285	0.877	T-cell surface protein tactile
7	9606.ENSP00000203629	0.868	Lymphocyte activation gene 3 protein
8	9606.ENSP00000312002	0.861	Hepatitis A virus cellular receptor 2
9	9606.ENSP00000370989	0.836	Programmed cell death 1 ligand 1
10	9606.ENSP00000403701	0.800	Beta-arrestin-2
11	9606.ENSP00000303939	0.779	Cytotoxic T-lymphocyte protein 4
12	9606.ENSP00000386559	0.732	T-cell surface glycoprotein CD8 alpha chain
13	9606.ENSP00000335062	0.729	Programmed cell death protein 1
14	9606.ENSP00000333919	0.717	B- and T-lymphocyte attenuator
15	9606.ENSP00000365380	0.717	Forkhead box protein P3
16	9606.ENSP00000011653	0.689	T-cell surface glycoprotein CD4
17	9606.ENSP00000216341	0.682	Granzyme B
18	9606.ENSP00000235933	0.681	CD160 antigen
19	9606.ENSP00000368538	0.657	Tumor necrosis factor receptor superfamily member 4
20	9606.ENSP00000328207	0.656	Tumor necrosis factor receptor superfamily member 18

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0005102	1.000	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0051239	0.998	regulation of multicellular organismal process
GO:0050794	0.998	regulation of cellular process
GO:0030155	0.992	regulation of cell adhesion
GO:0002695	0.992	negative regulation of leukocyte activation
GO:0048518	0.990	positive regulation of biological process
GO:0051249	0.990	regulation of lymphocyte activation
GO:0019222	0.986	regulation of metabolic process
GO:0001817	0.982	regulation of cytokine production
GO:0051240	0.981	positive regulation of multicellular organismal process
GO:1903037	0.981	regulation of leukocyte cell-cell adhesion
GO:0051250	0.975	negative regulation of lymphocyte activation
GO:0050868	0.967	negative regulation of T cell activation
GO:0001819	0.930	positive regulation of cytokine production
GO:0032653	0.867	regulation of interleukin-10 production
GO:0010605	0.816	negative regulation of macromolecule metabolic process
GO:0032655	0.567	regulation of interleukin-12 production
GO:0009987	0.553	cellular process
GO:0001818	0.504	negative regulation of cytokine production
GO:0032733	0.328	positive regulation of interleukin-10 production
GO:0048522	0.311	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009986	0.997	cell surface
GO:0016020	0.947	membrane
GO:0071944	0.934	cell periphery
GO:0005886	0.917	plasma membrane
GO:0005622	0.695	intracellular anatomical structure
GO:0043227	0.497	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]