StarFunc result for job id Q495M3

User Input

>input (483 residues)
MSVTKSTEGPQGAVAIKLDLMSPPESAKKLENKDSTFLDESPSESAGLKKTKGITVFQAL
IHLVKGNMGTGILGLPLAVKNAGILMGPLSLLVMGFIACHCMHILVKCAQRFCKRLNKPF
MDYGDTVMHGLEANPNAWLQNHAHWGRHIVSFFLIITQLGFCCVYIVFLADNLKQVVEAV
NSTTNNCYSNETVILTPTMDSRLYMLSFLPFLVLLVLIRNLRILTIFSMLANISMLVSLV
IIIQYITQEIPDPSRLPLVASWKTYPLFFGTAIFSFESIGVVLPLENKMKNARHFPAILS
LGMSIVTSLYIGMAALGYLRFGDDIKASISLNLPNCWLYQSVKLLYIAGILCTYALQFYV
PAEIIIPFAISRVSTRWALPLDLSIRLVMVCLTCLLAILIPRLDLVISLVGSVSGTALAL
IIPPLLEVTTFYSEGMSPLTIFKDALISILGFVGFVVGTYQALDELLKSEDSHPFSNSTT
FVR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q495M3	1.000	1.000	2.316E-67	483	1.000	1.000	Q495M3.pdb.gz	S36A2_HUMAN Proton-coupled amino acid transporter 2 OS=Homo sapiens OX=9606 GN=SLC36A2 PE=1 SV=1
2	AFDB:Q8K415	0.912	0.916	8.380E-59	481	0.812	0.815	Q8K415.pdb.gz	S36A2_RAT Proton-coupled amino acid transporter 2 OS=Rattus norvegicus OX=10116 GN=Slc36a2 PE=1 SV=1
3	AFDB:Q8K4D3	0.877	0.891	2.434E-50	475	0.663	0.674	Q8K4D3.pdb.gz	S36A1_MOUSE Proton-coupled amino acid transporter 1 OS=Mus musculus OX=10090 GN=Slc36a1 PE=1 SV=1
4	AFDB:D2Y3F6	0.874	0.883	2.658E-50	478	0.694	0.701	D2Y3F6.pdb.gz	D2Y3F6_HUMAN Dct1 OS=Homo sapiens OX=9606 PE=2 SV=1
5	AFDB:Q6YBV0	0.820	0.786	3.365E-40	504	0.507	0.486	Q6YBV0.pdb.gz	S36A4_HUMAN Neutral amino acid uniporter 4 OS=Homo sapiens OX=9606 GN=SLC36A4 PE=1 SV=1
6	AFDB:Q8CH36	0.842	0.814	9.234E-40	500	0.493	0.476	Q8CH36.pdb.gz	S36A4_MOUSE Neutral amino acid uniporter 4 OS=Mus musculus OX=10090 GN=Slc36a4 PE=1 SV=1
7	AFDB:Q9W056	0.814	0.870	1.741E-27	451	0.311	0.333	Q9W056.pdb.gz	C1139_DROME Proton-coupled amino acid transporter-like protein CG1139 OS=Drosophila melanogaster OX=7227 GN=CG1139 PE=2 SV=1
8	AFDB:Q9VT04	0.813	0.834	1.008E-26	471	0.296	0.304	Q9VT04.pdb.gz	PATH_DROME Proton-coupled amino acid transporter-like protein pathetic OS=Drosophila melanogaster OX=7227 GN=path PE=1 SV=1
9	AFDB:Q9SVG0	0.728	0.802	4.712E-22	436	0.255	0.282	Q9SVG0.pdb.gz	AVT3C_ARATH Amino acid transporter AVT3C OS=Arabidopsis thaliana OX=3702 GN=AVT3C PE=1 SV=1
10	AFDB:Q4V5R4	0.786	0.824	4.924E-22	460	0.232	0.243	Q4V5R4.pdb.gz	POLYP_DROME Glutamate transporter polyphemus OS=Drosophila melanogaster OX=7227 GN=polyph PE=2 SV=1
11	PDB:7kgvB	0.678	0.802	9.471E-12	404	0.139	0.166	7kgvB.pdb.gz
12	PDB:7kgvA	0.598	0.785	8.703E-10	361	0.139	0.186	7kgvA.pdb.gz
13	PDB:7p9uB	0.548	0.578	4.239E-7	455	0.106	0.112	7p9uB.pdb.gz	Molecular basis for redox control by the human cystine/glutamate antiporter system xc .
14	PDB:7dskB	0.526	0.544	6.870E-7	464	0.126	0.131	7dskB.pdb.gz	Mechanism of substrate transport and inhibition of the human LAT1-4F2hc amino acid transporter.
15	PDB:7cmhB	0.555	0.580	1.327E-6	458	0.137	0.144	7cmhB.pdb.gz	Structural insight into the substrate recognition and transport mechanism of the human LAT2-4F2hc complex.
16	PDB:6jmqA	0.577	0.675	2.247E-6	403	0.118	0.141	6jmqA.pdb.gz	Cryo-EM structure of the human L-type amino acid transporter 1 in complex with glycoprotein CD98hc.
17	PDB:5j4nA	0.530	0.575	2.799E-6	437	0.116	0.128	5j4nA.pdb.gz	Insights into the molecular basis for substrate binding and specificity of the wild-type L-arginine/agmatine antiporter AdiC.
18	PDB:7d10A	0.471	0.502	5.902E-6	446	0.137	0.148	7d10A.pdb.gz
19	PDB:6li9B	0.560	0.587	1.483E-5	458	0.112	0.118	6li9B.pdb.gz	Cryo-EM structure of the human heteromeric amino acid transporter b0,+AT-rBAT.
20	PDB:7d99A	0.482	0.290	2.202E-5	891	0.151	0.082	7d99A.pdb.gz	Structures and an activation mechanism of human potassium-chloride cotransporters.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D2Y3F6	0.0	675	478	0.694	0.701	D2Y3F6_HUMAN Dct1 OS=Homo sapiens OX=9606 PE=2 SV=1
2	Q495M3	0.0	982	483	1.000	1.000	S36A2_HUMAN Proton-coupled amino acid transporter 2 OS=Homo sapiens OX=9606 GN=SLC36A2 PE=1 SV=1
3	Q7Z2H8	0.0	675	476	0.694	0.704	S36A1_HUMAN Proton-coupled amino acid transporter 1 OS=Homo sapiens OX=9606 GN=SLC36A1 PE=1 SV=1
4	Q8BHK3	0.0	768	478	0.805	0.814	S36A2_MOUSE Proton-coupled amino acid transporter 2 OS=Mus musculus OX=10090 GN=Slc36a2 PE=1 SV=1
5	Q8K415	0.0	764	481	0.807	0.811	S36A2_RAT Proton-coupled amino acid transporter 2 OS=Rattus norvegicus OX=10116 GN=Slc36a2 PE=1 SV=1
6	Q8K4D3	0.0	616	475	0.673	0.684	S36A1_MOUSE Proton-coupled amino acid transporter 1 OS=Mus musculus OX=10090 GN=Slc36a1 PE=1 SV=1
7	Q924A5	0.0	624	475	0.683	0.695	S36A1_RAT Proton-coupled amino acid transporter 1 OS=Rattus norvegicus OX=10116 GN=Slc36a1 PE=1 SV=1
8	Q6YBV0	1.12e-162	471	504	0.497	0.476	S36A4_HUMAN Neutral amino acid uniporter 4 OS=Homo sapiens OX=9606 GN=SLC36A4 PE=1 SV=1
9	Q8CH36	5.55e-160	464	500	0.482	0.466	S36A4_MOUSE Neutral amino acid uniporter 4 OS=Mus musculus OX=10090 GN=Slc36a4 PE=1 SV=1
10	Q9W056	6.06e-68	226	451	0.319	0.341	C1139_DROME Proton-coupled amino acid transporter-like protein CG1139 OS=Drosophila melanogaster OX=7227 GN=CG1139 PE=2 SV=1
11	Q9VT04	2.04e-60	207	471	0.286	0.293	PATH_DROME Proton-coupled amino acid transporter-like protein pathetic OS=Drosophila melanogaster OX=7227 GN=path PE=1 SV=1
12	Q9SVG0	3.68e-38	146	436	0.273	0.303	AVT3C_ARATH Amino acid transporter AVT3C OS=Arabidopsis thaliana OX=3702 GN=AVT3C PE=1 SV=1
13	F4ILY9	2.42e-34	135	413	0.244	0.286	AVT3B_ARATH Amino acid transporter AVT3B OS=Arabidopsis thaliana OX=3702 GN=AVT3B PE=2 SV=1
14	Q4V5R4	2.31e-31	127	460	0.226	0.237	POLYP_DROME Glutamate transporter polyphemus OS=Drosophila melanogaster OX=7227 GN=polyph PE=2 SV=1
15	Q9SF09	1.87e-30	124	432	0.228	0.255	ANT1_ARATH Amino acid transporter ANT1 OS=Arabidopsis thaliana OX=3702 GN=ANT1 PE=1 SV=1
16	P50944	3.60e-30	126	713	0.263	0.178	AVT4_YEAST Vacuolar amino acid transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AVT4 PE=1 SV=1
17	Q10074	1.06e-27	119	656	0.228	0.168	AVT3_SCHPO Vacuolar amino acid transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=avt3 PE=1 SV=1
18	P36062	1.10e-25	112	692	0.255	0.178	AVT3_YEAST Vacuolar amino acid transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AVT3 PE=1 SV=1
19	Q9FKY3	6.66e-22	100	427	0.236	0.267	AVT3A_ARATH Amino acid transporter AVT3A OS=Arabidopsis thaliana OX=3702 GN=AVT3A PE=1 SV=1
20	Q38B26	3.83e-18	89.7	576	0.188	0.158	Q38B26_TRYB2 Amino acid tansporter, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.1170 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01490 Aa_trans	3.8e-70	248.3	Transmembrane amino acid transporter protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000334223

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000346298	0.932	Sodium- and chloride-dependent transporter XTRP3
2	9606.ENSP00000305302	0.910	Sodium-dependent neutral amino acid transporter B(0)AT1
3	9606.ENSP00000323549	0.910	Sodium-dependent neutral amino acid transporter B(0)AT3
4	9606.ENSP00000478639	0.826	Amino acid transporter
5	9606.ENSP00000317382	0.809	Proton-coupled amino acid transporter 4
6	9606.ENSP00000243389	0.804	Proton-coupled amino acid transporter 1
7	9606.ENSP00000392411	0.736	Solute carrier family 13 member 2
8	9606.ENSP00000338627	0.726	Orphan sodium- and chloride-dependent neurotransmitter transporter NTT5
9	9606.ENSP00000393847	0.681	Group 10 secretory phospholipase A2
10	9606.ENSP00000381775	0.626	Tumor necrosis factor ligand superfamily member 11
11	9606.ENSP00000225328	0.600	P2X purinoceptor 5
12	9606.ENSP00000256689	0.572	Sodium-coupled neutral amino acid transporter 2
13	9606.ENSP00000354558	0.558	Serine/threonine-protein kinase mTOR
14	9606.ENSP00000382237	0.557	Transmembrane protein 26
15	9606.ENSP00000353646	0.555	Puratrophin-1
16	9606.ENSP00000231061	0.554	SPARC
17	9606.ENSP00000432568	0.543	Spectrin beta chain, non-erythrocytic 2
18	9606.ENSP00000399136	0.525	Sodium- and chloride-dependent betaine transporter
19	9606.ENSP00000253188	0.519	Asc-type amino acid transporter 1
20	9606.ENSP00000444408	0.506	Neutral amino acid transporter B(0)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015295	1.000	solute:proton symporter activity
GO:0005416	1.000	amino acid:monoatomic cation symporter activity
GO:0015179	0.999	L-amino acid transmembrane transporter activity
GO:0022858	0.996	alanine transmembrane transporter activity
GO:0005280	0.810	amino acid:proton symporter activity
GO:0015187	0.799	glycine transmembrane transporter activity
GO:0005515	0.720	protein binding
GO:1901702	0.645	salt transmembrane transporter activity
GO:0005297	0.644	proline:proton symporter activity
GO:0015193	0.530	L-proline transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0055085	0.996	transmembrane transport
GO:0015711	0.995	organic anion transport
GO:0006865	0.993	amino acid transport
GO:0006811	0.879	monoatomic ion transport
GO:1905039	0.767	carboxylic acid transmembrane transport
GO:0003333	0.760	amino acid transmembrane transport
GO:0015804	0.721	neutral amino acid transport
GO:0015807	0.353	L-amino acid transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043227	0.999	membrane-bounded organelle
GO:0005737	0.979	cytoplasm
GO:0043231	0.958	intracellular membrane-bounded organelle
GO:0005576	0.862	extracellular region
GO:0031982	0.808	vesicle
GO:0005615	0.781	extracellular space
GO:0031090	0.659	organelle membrane
GO:0043230	0.559	extracellular organelle
GO:0098588	0.548	bounding membrane of organelle
GO:0070062	0.546	extracellular exosome
GO:0000323	0.521	lytic vacuole
GO:0012505	0.440	endomembrane system
GO:0005764	0.401	lysosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]