StarFunc result for job id Q495N2

User Input

>input (470 residues)
MSLLGRDYNSELNSLDNGPQSPSESSSSITSENVHPAGEAGLSMMQTLIHLLKCNIGTGL
LGLPLAIKNAGLLVGPVSLLAIGVLTVHCMVILLNCAQHLSQRLQKTFVNYGEATMYGLE
TCPNTWLRAHAVWGRYTVSFLLVITQLGFCSVYFMFMADNLQQMVEKAHVTSNICQPREI
LTLTPILDIRFYMLIILPFLILLVFIQNLKVLSVFSTLANITTLGSMALIFEYIMEGIPY
PSNLPLMANWKTFLLFFGTAIFTFEGVGMVLPLKNQMKHPQQFSFVLYLGMSIVIILYIL
LGTLGYMKFGSDTQASITLNLPNCWLYQSVKLMYSIGIFFTYALQFHVPAEIIIPFAISQ
VSESWALFVDLSVRSALVCLTCVSAILIPRLDLVISLVGSVSSSALALIIPALLEIVIFY
SEDMSCVTIAKDIMISIVGLLGCIFGTYQALYELPQPISHSMANSTGVHA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D2Y3F6	0.902	0.887	1.129E-46	478	0.611	0.600	D2Y3F6.pdb.gz	D2Y3F6_HUMAN Dct1 OS=Homo sapiens OX=9606 PE=2 SV=1
2	AFDB:Q8K4D3	0.911	0.902	1.141E-45	475	0.587	0.581	Q8K4D3.pdb.gz	S36A1_MOUSE Proton-coupled amino acid transporter 1 OS=Mus musculus OX=10090 GN=Slc36a1 PE=1 SV=1
3	AFDB:Q8K415	0.877	0.858	3.012E-44	481	0.572	0.559	Q8K415.pdb.gz	S36A2_RAT Proton-coupled amino acid transporter 2 OS=Rattus norvegicus OX=10116 GN=Slc36a2 PE=1 SV=1
4	AFDB:Q495M3	0.882	0.859	1.803E-43	483	0.572	0.557	Q495M3.pdb.gz	S36A2_HUMAN Proton-coupled amino acid transporter 2 OS=Homo sapiens OX=9606 GN=SLC36A2 PE=1 SV=1
5	AFDB:Q8CH36	0.880	0.829	7.599E-39	500	0.470	0.442	Q8CH36.pdb.gz	S36A4_MOUSE Neutral amino acid uniporter 4 OS=Mus musculus OX=10090 GN=Slc36a4 PE=1 SV=1
6	AFDB:Q6YBV0	0.869	0.811	4.548E-38	504	0.472	0.440	Q6YBV0.pdb.gz	S36A4_HUMAN Neutral amino acid uniporter 4 OS=Homo sapiens OX=9606 GN=SLC36A4 PE=1 SV=1
7	AFDB:Q9W056	0.836	0.870	4.332E-26	451	0.304	0.317	Q9W056.pdb.gz	C1139_DROME Proton-coupled amino acid transporter-like protein CG1139 OS=Drosophila melanogaster OX=7227 GN=CG1139 PE=2 SV=1
8	AFDB:Q9VT04	0.832	0.830	2.085E-25	471	0.285	0.285	Q9VT04.pdb.gz	PATH_DROME Proton-coupled amino acid transporter-like protein pathetic OS=Drosophila melanogaster OX=7227 GN=path PE=1 SV=1
9	AFDB:Q9FKY3	0.741	0.812	2.152E-22	427	0.260	0.286	Q9FKY3.pdb.gz	AVT3A_ARATH Amino acid transporter AVT3A OS=Arabidopsis thaliana OX=3702 GN=AVT3A PE=1 SV=1
10	AFDB:Q9SVG0	0.755	0.812	4.930E-22	436	0.274	0.296	Q9SVG0.pdb.gz	AVT3C_ARATH Amino acid transporter AVT3C OS=Arabidopsis thaliana OX=3702 GN=AVT3C PE=1 SV=1
11	PDB:7kgvB	0.677	0.779	1.292E-10	404	0.132	0.153	7kgvB.pdb.gz
12	PDB:7kgvA	0.574	0.732	1.379E-8	361	0.132	0.172	7kgvA.pdb.gz
13	PDB:7p9uB	0.556	0.571	4.379E-6	455	0.117	0.121	7p9uB.pdb.gz	Molecular basis for redox control by the human cystine/glutamate antiporter system xc .
14	PDB:7dskB	0.552	0.558	1.095E-5	464	0.113	0.114	7dskB.pdb.gz	Mechanism of substrate transport and inhibition of the human LAT1-4F2hc amino acid transporter.
15	PDB:6jmqA	0.571	0.653	1.553E-5	403	0.121	0.141	6jmqA.pdb.gz	Cryo-EM structure of the human L-type amino acid transporter 1 in complex with glycoprotein CD98hc.
16	PDB:7cmhB	0.610	0.623	1.622E-5	458	0.113	0.116	7cmhB.pdb.gz	Structural insight into the substrate recognition and transport mechanism of the human LAT2-4F2hc complex.
17	PDB:7d10A	0.470	0.490	1.770E-5	446	0.132	0.139	7d10A.pdb.gz
18	PDB:6li9B	0.568	0.581	4.425E-5	458	0.115	0.118	6li9B.pdb.gz	Cryo-EM structure of the human heteromeric amino acid transporter b0,+AT-rBAT.
19	PDB:7s1xB	0.423	0.255	6.847E-5	871	0.143	0.077	7s1xB.pdb.gz	Structural basis for inhibition of the Cation-chloride cotransporter NKCC1 by the diuretic drug bumetanide
20	PDB:4djiA	0.560	0.538	7.471E-5	493	0.145	0.138	4djiA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D2Y3F6	0.0	577	478	0.613	0.603	D2Y3F6_HUMAN Dct1 OS=Homo sapiens OX=9606 PE=2 SV=1
2	Q495M3	0.0	525	483	0.579	0.563	S36A2_HUMAN Proton-coupled amino acid transporter 2 OS=Homo sapiens OX=9606 GN=SLC36A2 PE=1 SV=1
3	Q7Z2H8	0.0	577	476	0.613	0.605	S36A1_HUMAN Proton-coupled amino acid transporter 1 OS=Homo sapiens OX=9606 GN=SLC36A1 PE=1 SV=1
4	Q8K4D3	0.0	532	475	0.594	0.587	S36A1_MOUSE Proton-coupled amino acid transporter 1 OS=Mus musculus OX=10090 GN=Slc36a1 PE=1 SV=1
5	Q924A5	0.0	540	475	0.598	0.592	S36A1_RAT Proton-coupled amino acid transporter 1 OS=Rattus norvegicus OX=10116 GN=Slc36a1 PE=1 SV=1
6	Q8BHK3	1.10e-178	511	478	0.564	0.554	S36A2_MOUSE Proton-coupled amino acid transporter 2 OS=Mus musculus OX=10090 GN=Slc36a2 PE=1 SV=1
7	Q8K415	5.31e-177	506	481	0.557	0.545	S36A2_RAT Proton-coupled amino acid transporter 2 OS=Rattus norvegicus OX=10116 GN=Slc36a2 PE=1 SV=1
8	Q8CH36	6.10e-146	428	500	0.464	0.436	S36A4_MOUSE Neutral amino acid uniporter 4 OS=Mus musculus OX=10090 GN=Slc36a4 PE=1 SV=1
9	Q6YBV0	6.66e-145	426	504	0.462	0.431	S36A4_HUMAN Neutral amino acid uniporter 4 OS=Homo sapiens OX=9606 GN=SLC36A4 PE=1 SV=1
10	Q9W056	3.90e-61	208	451	0.313	0.326	C1139_DROME Proton-coupled amino acid transporter-like protein CG1139 OS=Drosophila melanogaster OX=7227 GN=CG1139 PE=2 SV=1
11	Q9VT04	1.85e-59	204	471	0.294	0.293	PATH_DROME Proton-coupled amino acid transporter-like protein pathetic OS=Drosophila melanogaster OX=7227 GN=path PE=1 SV=1
12	F4ILY9	1.22e-46	168	413	0.266	0.303	AVT3B_ARATH Amino acid transporter AVT3B OS=Arabidopsis thaliana OX=3702 GN=AVT3B PE=2 SV=1
13	Q9SVG0	4.16e-44	162	436	0.268	0.289	AVT3C_ARATH Amino acid transporter AVT3C OS=Arabidopsis thaliana OX=3702 GN=AVT3C PE=1 SV=1
14	Q9SF09	1.25e-36	142	432	0.257	0.280	ANT1_ARATH Amino acid transporter ANT1 OS=Arabidopsis thaliana OX=3702 GN=ANT1 PE=1 SV=1
15	Q4V5R4	4.69e-34	135	460	0.245	0.250	POLYP_DROME Glutamate transporter polyphemus OS=Drosophila melanogaster OX=7227 GN=polyph PE=2 SV=1
16	P50944	4.03e-33	135	713	0.226	0.149	AVT4_YEAST Vacuolar amino acid transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AVT4 PE=1 SV=1
17	Q9FKY3	1.05e-29	122	427	0.247	0.272	AVT3A_ARATH Amino acid transporter AVT3A OS=Arabidopsis thaliana OX=3702 GN=AVT3A PE=1 SV=1
18	Q10074	4.45e-28	119	656	0.270	0.194	AVT3_SCHPO Vacuolar amino acid transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=avt3 PE=1 SV=1
19	P36062	2.10e-25	112	692	0.251	0.171	AVT3_YEAST Vacuolar amino acid transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AVT3 PE=1 SV=1
20	Q38B26	6.94e-21	97.8	576	0.223	0.182	Q38B26_TRYB2 Amino acid tansporter, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.1170 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01490 Aa_trans	7.3e-65	230.9	Transmembrane amino acid transporter protein
2	PF03188 Cytochrom_B561	18	16.9	Eukaryotic cytochrome b561
3	PF03929 PepSY_TM	2.7e+02	12.7	PepSY-associated TM region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000017863

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000019338	0.560	Zinc finger and BTB domain containing 22
2	9601.ENSPPYP00000008284	0.555	Nuclear envelope phosphatase-regulatory subunit 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015175	1.000	neutral L-amino acid transmembrane transporter activity
GO:0005416	1.000	amino acid:monoatomic cation symporter activity
GO:0015295	0.999	solute:proton symporter activity
GO:0015179	0.986	L-amino acid transmembrane transporter activity
GO:0022858	0.758	alanine transmembrane transporter activity
GO:0005280	0.735	amino acid:proton symporter activity
GO:0005488	0.383	binding
GO:1901702	0.374	salt transmembrane transporter activity
GO:0005515	0.331	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0015711	0.995	organic anion transport
GO:0046942	0.994	carboxylic acid transport
GO:0071705	0.991	nitrogen compound transport
GO:0055085	0.990	transmembrane transport
GO:0006865	0.982	amino acid transport
GO:1905039	0.393	carboxylic acid transmembrane transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005737	0.999	cytoplasm
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0005886	0.966	plasma membrane
GO:0012505	0.885	endomembrane system
GO:0031090	0.807	organelle membrane
GO:0098588	0.440	bounding membrane of organelle
GO:0005634	0.384	nucleus
GO:0005764	0.341	lysosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]