StarFunc result for job id Q495W5

User Input

>input (492 residues)
MAAGPIRVVLVLLGVLSVCAASGHGSVAEREAGGEAEWAEPWDGAVFRPPSALGAVGVTR
SSGTPRPGREEAGDLPVLLWWSPGLFPHFPGDSERIECARGACVASRNRRALRDSRTRAL
LFYGTDFRASAAPLPRLAHQSWALLHEESPLNNFLLSHGPGIRLFNLTSTFSRHSDYPLS
LQWLPGTAYLRRPVPPPMERAEWRRRGYAPLLYLQSHCDVPADRDRYVRELMRHIPVDSY
GKCLQNRELPTARLQDTATATTEDPELLAFLSRYKFHLALENAICNDYMTEKLWRPMHLG
AVPVYRGSPSVRDWMPNNHSVILIDDFESPQKLAEFIDFLDKNDEEYMKYLAYKQPGGIT
NQFLLDSLKHREWGVNDPLLPNYLNGFECFVCDYELARLDAEKAHAASPGDSPVFEPHIA
QPSHMDCPVPTPGFGNVEEIPENDSWKEMWLQDYWQGLDQGEALTAMIHNNETEQTKFWD
YLHEIFMKRQHL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q495W5	1.000	1.000	2.073E-95	492	1.000	1.000	Q495W5.pdb.gz	FUT11_HUMAN Alpha-(1,3)-fucosyltransferase 11 OS=Homo sapiens OX=9606 GN=FUT11 PE=1 SV=1
2	AFDB:Q6P4F1	0.775	0.796	8.029E-45	479	0.362	0.372	Q6P4F1.pdb.gz	FUT10_HUMAN Alpha-(1,3)-fucosyltransferase 10 OS=Homo sapiens OX=9606 GN=FUT10 PE=1 SV=2
3	AFDB:Q5F2L2	0.766	0.783	9.708E-44	481	0.386	0.395	Q5F2L2.pdb.gz	FUT10_MOUSE Alpha-(1,3)-fucosyltransferase 10 OS=Mus musculus OX=10090 GN=Fut10 PE=2 SV=1
4	AFDB:O88819	0.406	0.540	1.466E-14	359	0.157	0.214	O88819.pdb.gz	FUT9_MOUSE 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase 9 OS=Mus musculus OX=10090 GN=Fut9 PE=1 SV=1
5	AFDB:Q9LJK1	0.476	0.468	1.773E-13	501	0.150	0.148	Q9LJK1.pdb.gz	FUT11_ARATH Glycoprotein 3-alpha-L-fucosyltransferase A OS=Arabidopsis thaliana OX=3702 GN=FUT11 PE=1 SV=1
6	AFDB:Q9C8W3	0.418	0.499	4.804E-13	401	0.193	0.237	Q9C8W3.pdb.gz	FUT13_ARATH Alpha-(1,4)-fucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=FUT13 PE=2 SV=2
7	AFDB:Q9FX97	0.470	0.452	7.080E-13	513	0.140	0.135	Q9FX97.pdb.gz	FUT12_ARATH Putative fucosyltransferase-like protein OS=Arabidopsis thaliana OX=3702 GN=FUT12 PE=2 SV=1
8	AFDB:G5EDR5	0.389	0.436	2.320E-11	433	0.134	0.152	G5EDR5.pdb.gz	FUTA_CAEEL Alpha-(1,3)-fucosyltransferase fut-1 OS=Caenorhabditis elegans OX=6239 GN=fut-1 PE=1 SV=1
9	AFDB:O30511	0.324	0.333	1.478E-9	478	0.118	0.121	O30511.pdb.gz	FUCT_HELPX Alpha-(1,3)-fucosyltransferase FucT OS=Helicobacter pylori OX=210 GN=fucT PE=1 SV=1
10	AFDB:Q8S4F6	0.318	0.310	1.222E-3	510	0.106	0.102	Q8S4F6.pdb.gz	SQD2_ARATH Sulfoquinovosyl transferase SQD2 OS=Arabidopsis thaliana OX=3702 GN=SQD2 PE=1 SV=1
11	PDB:5f84A	0.258	0.330	1.439E-3	365	0.065	0.088	5f84A.pdb.gz	Structural analysis of Notch-regulating Rumi reveals basis for pathogenic mutations.
12	PDB:5hvmB	0.255	0.274	2.798E-3	452	0.077	0.084	5hvmB.pdb.gz	Structural and In Vivo Studies on Trehalose-6-Phosphate Synthase from Pathogenic Fungi Provide Insights into Its Catalytic Mechanism, Biological Necessity, and Potential for Novel Antifungal Drug Design.
13	PDB:5l0tA	0.225	0.295	4.606E-3	356	0.067	0.093	5l0tA.pdb.gz	Structural basis of Notch O-glucosylation and O-xylosylation by mammalian protein-O-glucosyltransferase 1 (POGLUT1).
14	PDB:1bgtA	0.293	0.413	5.748E-3	329	0.053	0.079	1bgtA.pdb.gz
15	PDB:1ixyA	0.277	0.368	8.471E-3	351	0.059	0.083	1ixyA.pdb.gz	A Base-flipping Mechanism for the T4 Phage beta-Glucosyltransferase and Identification of a Transition-state Analog
16	PDB:3s27H	0.304	0.210	8.471E-3	797	0.110	0.068	3s27H.pdb.gz	The Structure of Sucrose Synthase-1 from Arabidopsis thaliana and Its Functional Implications.
17	PDB:5hutA	0.272	0.281	1.839E-2	469	0.061	0.064	5hutA.pdb.gz	Structural and In Vivo Studies on Trehalose-6-Phosphate Synthase from Pathogenic Fungi Provide Insights into Its Catalytic Mechanism, Biological Necessity, and Potential for Novel Antifungal Drug Design.
18	PDB:7au2A	0.270	0.212	2.565E-2	686	0.100	0.071	7au2A.pdb.gz
19	PDB:5hvoA	0.282	0.298	3.576E-2	459	0.069	0.074	5hvoA.pdb.gz	Structural and In Vivo Studies on Trehalose-6-Phosphate Synthase from Pathogenic Fungi Provide Insights into Its Catalytic Mechanism, Biological Necessity, and Potential for Novel Antifungal Drug Design.
20	PDB:7scjA	0.221	0.198	9.691E-2	563	0.055	0.048	7scjA.pdb.gz	Structural basis for heparan sulfate co-polymerase action by the EXT1-2 complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q495W5	0.0	1017	492	1.000	1.000	FUT11_HUMAN Alpha-(1,3)-fucosyltransferase 11 OS=Homo sapiens OX=9606 GN=FUT11 PE=1 SV=1
2	Q6P4F1	1.11e-108	333	479	0.384	0.395	FUT10_HUMAN Alpha-(1,3)-fucosyltransferase 10 OS=Homo sapiens OX=9606 GN=FUT10 PE=1 SV=2
3	Q5F2L2	1.83e-106	327	481	0.388	0.397	FUT10_MOUSE Alpha-(1,3)-fucosyltransferase 10 OS=Mus musculus OX=10090 GN=Fut10 PE=2 SV=1
4	P22083	4.09e-19	92.4	530	0.152	0.142	FUT4_HUMAN Alpha-(1,3)-fucosyltransferase 4 OS=Homo sapiens OX=9606 GN=FUT4 PE=1 SV=3
5	Q62994	5.11e-19	91.7	433	0.154	0.176	FUT4_RAT Alpha-(1,3)-fucosyltransferase 4 OS=Rattus norvegicus OX=10116 GN=Fut4 PE=2 SV=1
6	Q99JB3	1.35e-18	89.4	359	0.195	0.267	FUT9_RAT 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase 9 OS=Rattus norvegicus OX=10116 GN=Fut9 PE=1 SV=1
7	O88819	1.57e-18	89.4	359	0.195	0.267	FUT9_MOUSE 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase 9 OS=Mus musculus OX=10090 GN=Fut9 PE=1 SV=1
8	P21217	2.04e-18	89.0	361	0.183	0.249	FUT3_HUMAN 3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase FUT3 OS=Homo sapiens OX=9606 GN=FUT3 PE=1 SV=1
9	Q9P1W6	2.20e-18	89.0	361	0.183	0.249	Q9P1W6_HUMAN Fucosyltransferase OS=Homo sapiens OX=9606 GN=FUT3 PE=2 SV=1
10	P51993	2.30e-18	88.6	359	0.150	0.206	FUT6_HUMAN 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase FUT6 OS=Homo sapiens OX=9606 GN=FUT6 PE=1 SV=1
11	G5EFP5	3.21e-18	89.0	400	0.154	0.190	FUTC_CAEEL Alpha-(1,3)-fucosyltransferase fut-3 OS=Caenorhabditis elegans OX=6239 GN=fut-3 PE=1 SV=1
12	Q9Y231	5.55e-18	87.4	359	0.191	0.262	FUT9_HUMAN 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase 9 OS=Homo sapiens OX=9606 GN=FUT9 PE=1 SV=2
13	Q11128	1.03e-17	87.0	374	0.154	0.203	FUT5_HUMAN 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase FUT5 OS=Homo sapiens OX=9606 GN=FUT5 PE=1 SV=1
14	Q6P7E6	1.70e-17	86.3	359	0.152	0.209	Q6P7E6_HUMAN Fucosyltransferase OS=Homo sapiens OX=9606 GN=FUT6 PE=1 SV=1
15	Q11127	1.91e-17	86.7	433	0.146	0.166	FUT4_MOUSE Alpha-(1,3)-fucosyltransferase 4 OS=Mus musculus OX=10090 GN=Fut4 PE=1 SV=1
16	G5EDR5	5.24e-16	82.4	433	0.104	0.118	FUTA_CAEEL Alpha-(1,3)-fucosyltransferase fut-1 OS=Caenorhabditis elegans OX=6239 GN=fut-1 PE=1 SV=1
17	Q9C8W3	1.16e-15	80.9	401	0.118	0.145	FUT13_ARATH Alpha-(1,4)-fucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=FUT13 PE=2 SV=2
18	Q9VUL9	2.88e-15	80.5	503	0.138	0.135	FUCTA_DROME Glycoprotein 3-alpha-L-fucosyltransferase A OS=Drosophila melanogaster OX=7227 GN=FucTA PE=1 SV=2
19	Q11131	2.02e-14	77.0	389	0.175	0.221	FUT7_MOUSE Alpha-(1,3)-fucosyltransferase 7 OS=Mus musculus OX=10090 GN=Fut7 PE=1 SV=1
20	G5EEE1	7.36e-14	75.5	392	0.128	0.161	FUTE_CAEEL Alpha-(1,3)-fucosyltransferase fut-6 OS=Caenorhabditis elegans OX=6239 GN=fut-6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00852 Glyco_transf_10	2.5e-31	120.3	Glycosyltransferase family 10 (fucosyltransferase) C-term
2	PF17039 Glyco_tran_10_N	4.1e-06	38.6	Fucosyltransferase, N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361932

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000353910	0.824	Alpha-(1,6)-fucosyltransferase
2	9606.ENSP00000312021	0.785	Galactoside 2-alpha-L-fucosyltransferase 1
3	9606.ENSP00000339613	0.742	GDP-fucose protein O-fucosyltransferase 2
4	9606.ENSP00000387498	0.652	Galactoside 2-alpha-L-fucosyltransferase 2
5	9606.ENSP00000364902	0.615	GDP-fucose protein O-fucosyltransferase 1
6	9606.ENSP00000454748	0.595	Leucine-rich repeat-containing protein 9
7	9606.ENSP00000164305	0.578	GPI mannosyltransferase 3
8	9606.ENSP00000307297	0.558	Carbohydrate sulfotransferase 14
9	9606.ENSP00000480884	0.547	Type 2 lactosamine alpha-2,3-sialyltransferase
10	9606.ENSP00000261483	0.546	Alpha-mannosidase 2
11	9606.ENSP00000452948	0.542	Alpha-mannosidase 2x
12	9606.ENSP00000430236	0.524	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase
13	9606.ENSP00000316173	0.509	Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase
14	9606.ENSP00000370194	0.500	GDP-mannose 4,6 dehydratase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008417	1.000	fucosyltransferase activity
GO:0005515	0.999	protein binding
GO:0046920	0.948	alpha-(1->3)-fucosyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008152	0.999	metabolic process
GO:0070085	0.994	glycosylation
GO:0071704	0.840	organic substance metabolic process
GO:0044238	0.819	primary metabolic process
GO:0009987	0.804	cellular process
GO:0044237	0.784	cellular metabolic process
GO:0009058	0.770	biosynthetic process
GO:0006807	0.768	nitrogen compound metabolic process
GO:1901576	0.764	organic substance biosynthetic process
GO:1901135	0.759	carbohydrate derivative metabolic process
GO:0043170	0.759	macromolecule metabolic process
GO:1901564	0.749	organonitrogen compound metabolic process
GO:0019538	0.743	protein metabolic process
GO:1901137	0.731	carbohydrate derivative biosynthetic process
GO:0044249	0.723	cellular biosynthetic process
GO:0044260	0.686	cellular macromolecule metabolic process
GO:0009100	0.682	glycoprotein metabolic process
GO:0009059	0.674	macromolecule biosynthetic process
GO:1901566	0.668	organonitrogen compound biosynthetic process
GO:0036211	0.631	protein modification process
GO:0034645	0.631	cellular macromolecule biosynthetic process
GO:0006486	0.596	protein glycosylation
GO:0005975	0.322	carbohydrate metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	0.999	Golgi apparatus
GO:0016020	0.997	membrane
GO:0031090	0.982	organelle membrane
GO:0043233	0.956	organelle lumen
GO:0070013	0.949	intracellular organelle lumen
GO:0000139	0.949	Golgi membrane
GO:0005654	0.778	nucleoplasm
GO:0005783	0.743	endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.

[back to server]