StarFunc result for job id Q495Y8

User Input

>input (402 residues)
MDRTETRFRKRGQITGKITTSRQPHPQNEQSPQRSTSGYPLQEVVDDEMLGPSAPGVDPS
PPCRSLGWKRKREWSDESEEEPEKELAPEPEETWVVEMLCGLKMKLKQQRVSPILPEHHK
DFNSQLAPGVDPSPPHRSFCWKRKMEWWDESEESLEEEPRKVLAPEPEEIWVAEMLCGLK
MKLKRRRVSLVLPEHHEAFNRLLEDPVIKRFLAWDKDLRVSDKYLLAMVIAYFSRAGFPS
WQYQRIHFFLALYLANDMEEDDEDSKQNIFHFLYRKNRSRIPLLRKPWFQLGHSMNPRAR
KNRSRIPLLRKRRFQLYRSTNPRARKNRSRIPLLRKRRFQLYRSMNSRARKNRSQIVLFQ
KRRFHFFCSMSCRAWVSPEELEEIQAYDPEHWVWARDRAHLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0CI01	0.659	0.659	1.941E-55	402	0.993	0.993	P0CI01.pdb.gz	SPDE6_HUMAN Speedy protein E6 OS=Homo sapiens OX=9606 GN=SPDYE6 PE=1 SV=2
2	AFDB:A6NLX3	0.403	0.669	6.449E-23	237	0.410	0.696	A6NLX3.pdb.gz	SPDE4_HUMAN Speedy protein E4 OS=Homo sapiens OX=9606 GN=SPDYE4 PE=1 SV=2
3	AFDB:Q16630	0.096	0.080	2.617E-1	551	0.149	0.109	Q16630.pdb.gz	CPSF6_HUMAN Cleavage and polyadenylation specificity factor subunit 6 OS=Homo sapiens OX=9606 GN=CPSF6 PE=1 SV=2
4	AFDB:Q9NRI5	0.096	0.059	4.574E-1	854	0.204	0.096	Q9NRI5.pdb.gz	DISC1_HUMAN Disrupted in schizophrenia 1 protein OS=Homo sapiens OX=9606 GN=DISC1 PE=1 SV=3
5	AFDB:M9NDQ8	0.095	0.076	5.114E-1	530	0.134	0.102	M9NDQ8.pdb.gz	M9NDQ8_DROME Nuclear fallout, isoform G OS=Drosophila melanogaster OX=7227 GN=nuf PE=4 SV=1
6	PDB:7kpvB	0.132	0.174	6.781E-1	290	0.042	0.059	7kpvB.pdb.gz
7	PDB:7egb9	0.142	0.188	7.171E-1	287	0.092	0.129	7egb9.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
8	AFDB:B7ZQA9	0.084	0.078	8.453E-1	445	0.124	0.112	B7ZQA9.pdb.gz	P5F12_XENLA POU domain, class 5, transcription factor 1.2 OS=Xenopus laevis OX=8355 GN=pou5f1.2 PE=1 SV=1
9	AFDB:Q8AWX9	0.106	0.066	8.453E-1	806	0.112	0.056	Q8AWX9.pdb.gz
10	AFDB:Q55FW7	0.107	0.060	1.182	837	0.090	0.043	Q55FW7.pdb.gz	GLE1_DICDI mRNA export factor GLE1 OS=Dictyostelium discoideum OX=44689 GN=gle1 PE=3 SV=1
11	AFDB:Q3UPL0	0.098	0.046	1.321	1230	0.102	0.033	Q3UPL0.pdb.gz	SC31A_MOUSE Protein transport protein Sec31A OS=Mus musculus OX=10090 GN=Sec31a PE=1 SV=2
12	AFDB:Q8N715	0.074	0.054	1.321	623	0.189	0.122	Q8N715.pdb.gz	CC185_HUMAN Coiled-coil domain-containing protein 185 OS=Homo sapiens OX=9606 GN=CCDC185 PE=1 SV=2
13	PDB:6gzhB	0.152	0.223	2.191	252	0.047	0.075	6gzhB.pdb.gz	Small Molecules Co-targeting CKI alpha and the Transcriptional Kinases CDK7/9 Control AML in Preclinical Models.
14	PDB:1o0lA	0.075	0.132	2.317	188	0.035	0.074	1o0lA.pdb.gz
15	PDB:2w96A	0.141	0.209	2.739	249	0.027	0.044	2w96A.pdb.gz
16	PDB:6ikoA	0.077	0.089	2.739	303	0.070	0.092	6ikoA.pdb.gz
17	PDB:3hajA	0.068	0.085	2.896	286	0.080	0.112	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
18	PDB:6jt0A	0.071	0.056	3.621	542	0.022	0.017	6jt0A.pdb.gz	Structural insights into the mechanism of human soluble guanylate cyclase.
19	PDB:2k7wA	0.084	0.148	3.829	192	0.027	0.057	2k7wA.pdb.gz	BAX activation is initiated at a novel interaction site.
20	PDB:1wao1	0.084	0.074	4.528	471	0.032	0.028	1wao1.pdb.gz	Molecular Basis for Tpr Domain-Mediated Regulation of Protein Phosphatase 5

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0CI01	0.0	815	402	0.993	0.993	SPDE6_HUMAN Speedy protein E6 OS=Homo sapiens OX=9606 GN=SPDYE6 PE=1 SV=2
2	Q495Y8	0.0	822	402	1.000	1.000	SPDE2_HUMAN Speedy protein E2 OS=Homo sapiens OX=9606 GN=SPDYE2 PE=1 SV=2
3	P0DTA3	2.14e-116	342	265	0.460	0.698	SPD11_HUMAN Putative speedy protein E11 OS=Homo sapiens OX=9606 GN=SPDYE11 PE=5 SV=1
4	A6NLX3	6.06e-67	214	237	0.303	0.515	SPDE4_HUMAN Speedy protein E4 OS=Homo sapiens OX=9606 GN=SPDYE4 PE=1 SV=2
5	Q5IBH6	1.04e-58	194	268	0.254	0.381	SPE4A_MOUSE Speedy protein E4A OS=Mus musculus OX=10090 GN=Spdye4a PE=1 SV=1
6	Q9PU13	2.21e-18	87.0	299	0.139	0.187	SPD1A_XENLA Speedy protein 1-A OS=Xenopus laevis OX=8355 GN=spdya-a PE=1 SV=2
7	Q9YGL1	2.27e-17	84.0	298	0.112	0.151	SPD1B_XENLA Speedy protein 1-B OS=Xenopus laevis OX=8355 GN=spdya-b PE=1 SV=1
8	Q5MJ68	5.11e-16	80.1	293	0.102	0.140	SPDYC_HUMAN Speedy protein C OS=Homo sapiens OX=9606 GN=SPDYC PE=1 SV=1
9	Q4R1K5	7.38e-13	71.2	311	0.100	0.129	Q4R1K5_PIG Rapid inducer of G2/M progression in oocytes OS=Sus scrofa OX=9823 GN=RINGO PE=2 SV=1
10	A0A384MTT5	1.07e-12	70.5	313	0.097	0.125	A0A384MTT5_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 GN=SPDY1 PE=2 SV=1
11	Q5MJ70	1.07e-12	70.5	313	0.097	0.125	SPDYA_HUMAN Speedy protein A OS=Homo sapiens OX=9606 GN=SPDYA PE=1 SV=2
12	Q5IBH7	1.14e-12	70.5	310	0.139	0.181	SPDYA_MOUSE Speedy protein A OS=Mus musculus OX=10090 GN=Spdya PE=1 SV=2
13	Q961D9	2.6	33.1	1469	0.052	0.014	BCL9_DROME Protein BCL9 homolog OS=Drosophila melanogaster OX=7227 GN=lgs PE=1 SV=1
14	Q6WRI0	2.9	32.7	2623	0.055	0.008	IGS10_HUMAN Immunoglobulin superfamily member 10 OS=Homo sapiens OX=9606 GN=IGSF10 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11357 Spy1	6.6e-51	183.5	Cell cycle regulatory protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000421686

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000266970	0.800	Cyclin-dependent kinase 2
2	9606.ENSP00000378699	0.800	Cyclin-dependent kinase 1
3	9606.ENSP00000364721	0.679	Microtubule-associated protein RP/EB family member 1
4	9606.ENSP00000321656	0.600	M-phase inducer phosphatase 3
5	9606.ENSP00000470746	0.559	Zinc finger protein 841
6	9606.ENSP00000392726	0.516	POM121-like protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.337	enzyme binding
GO:0019901	0.330	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048518	0.992	positive regulation of biological process
GO:0050794	0.985	regulation of cellular process
GO:0080090	0.980	regulation of primary metabolic process
GO:0051171	0.973	regulation of nitrogen compound metabolic process
GO:0031323	0.969	regulation of cellular metabolic process
GO:0060255	0.968	regulation of macromolecule metabolic process
GO:0051726	0.917	regulation of cell cycle
GO:0009987	0.878	cellular process
GO:0048522	0.874	positive regulation of cellular process
GO:0051246	0.748	regulation of protein metabolic process
GO:0065009	0.645	regulation of molecular function
GO:0051174	0.632	regulation of phosphorus metabolic process
GO:0019220	0.624	regulation of phosphate metabolic process
GO:0050790	0.616	regulation of catalytic activity
GO:0043549	0.598	regulation of kinase activity
GO:0001932	0.598	regulation of protein phosphorylation
GO:0045859	0.594	regulation of protein kinase activity
GO:0009893	0.534	positive regulation of metabolic process
GO:1904029	0.510	regulation of cyclin-dependent protein kinase activity
GO:0008152	0.451	metabolic process
GO:0031325	0.446	positive regulation of cellular metabolic process
GO:0071704	0.382	organic substance metabolic process
GO:0051173	0.373	positive regulation of nitrogen compound metabolic process
GO:0022402	0.372	cell cycle process
GO:0010604	0.368	positive regulation of macromolecule metabolic process
GO:0045787	0.343	positive regulation of cell cycle
GO:0043170	0.319	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.996	nuclear lumen
GO:0005654	0.966	nucleoplasm
GO:0005829	0.915	cytosol
GO:0043232	0.641	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]