StarFunc result for job id Q496M5

User Input

>input (336 residues)
MYTVLTGTPPFMASPLSEMYQNIREGHYPEPAHLSANARRLIVHLLAPNPAERPSLDHLL
QDDFFTQGFTPDRLPAHSCHSPPIFAIPPPLGRIFRKVGQRLLTQCRPPCPFTPKEASGP
GEGGPDPDSMEWDGESSLSAKEVPCLEGPIHLVAQGTLQSDLAGPEGSRRPEVEAALRHL
QLCLDVGPPATQDPLGEQQPILWAPKWVDYSSKYGFGYQLLDGGRTGRHPHGPATPRREG
TLPTPVPPAGPGLCLLRFLASEHALLLLFSNGMVQVSFSGVPAQLVLSGEGEGLQLTLWE
QGSPGTSYSLDVPRSHGCAPTTGQHLHHALRMLQSI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q496M5	1.000	1.000	3.761E-63	336	1.000	1.000	Q496M5.pdb.gz	PLK5_HUMAN Inactive serine/threonine-protein kinase PLK5 OS=Homo sapiens OX=9606 GN=PLK5 PE=1 SV=4
2	AFDB:Q4FZD7	0.428	0.248	1.197E-33	595	0.643	0.363	Q4FZD7.pdb.gz	PLK5_MOUSE Inactive serine/threonine-protein kinase PLK5 OS=Mus musculus OX=10090 GN=Plk5 PE=1 SV=1
3	AFDB:A6H8T5	0.466	0.253	2.178E-21	657	0.330	0.169	A6H8T5.pdb.gz	A6H8T5_DANRE Serine/threonine-protein kinase PLK OS=Danio rerio OX=7955 GN=plk2 PE=2 SV=1
4	AFDB:Q9NYY3	0.439	0.222	3.844E-21	685	0.333	0.164	Q9NYY3.pdb.gz	PLK2_HUMAN Serine/threonine-protein kinase PLK2 OS=Homo sapiens OX=9606 GN=PLK2 PE=1 SV=3
5	AFDB:Q9R011	0.409	0.222	1.503E-20	647	0.357	0.185	Q9R011.pdb.gz	PLK3_RAT Serine/threonine-protein kinase PLK3 OS=Rattus norvegicus OX=10116 GN=Plk3 PE=1 SV=2
6	AFDB:Q4KMI8	0.353	0.207	3.696E-16	595	0.262	0.148	Q4KMI8.pdb.gz	Q4KMI8_DANRE Serine/threonine-protein kinase PLK OS=Danio rerio OX=7955 GN=ik:tdsubc_2d1 PE=1 SV=1
7	AFDB:F7HSC1	0.353	0.206	2.856E-15	603	0.280	0.156	F7HSC1.pdb.gz	F7HSC1_MACMU Serine/threonine-protein kinase PLK OS=Macaca mulatta OX=9544 GN=PLK1 PE=3 SV=1
8	AFDB:J3KR82	0.193	0.076	2.505E-7	892	0.229	0.086	J3KR82.pdb.gz	J3KR82_HUMAN Serine/threonine-protein kinase PLK4 OS=Homo sapiens OX=9606 GN=PLK4 PE=1 SV=1
9	AFDB:Q64702	0.200	0.074	4.177E-7	925	0.238	0.086	Q64702.pdb.gz	PLK4_MOUSE Serine/threonine-protein kinase PLK4 OS=Mus musculus OX=10090 GN=Plk4 PE=1 SV=2
10	AFDB:Q7ZVS3	0.195	0.074	2.430E-6	940	0.253	0.090	Q7ZVS3.pdb.gz	PLK4_DANRE Serine/threonine-protein kinase PLK4 OS=Danio rerio OX=7955 GN=plk4 PE=2 SV=2
11	PDB:5u6yA	0.187	0.138	1.350E-3	459	0.128	0.094	5u6yA.pdb.gz
12	PDB:4cztD	0.204	0.226	6.624E-3	302	0.062	0.070	4cztD.pdb.gz
13	PDB:4d28C	0.204	0.244	8.799E-3	279	0.062	0.075	4d28C.pdb.gz
14	PDB:7myjC	0.199	0.145	1.553E-2	465	0.125	0.090	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
15	PDB:6b1uA	0.196	0.150	2.740E-2	442	0.062	0.048	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
16	PDB:5ufuA	0.193	0.176	4.078E-2	369	0.051	0.046	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
17	PDB:2iwiB	0.167	0.225	6.424E-2	249	0.068	0.092	2iwiB.pdb.gz	Crystal structure of the PIM2 kinase in complex with an organoruthenium inhibitor.
18	PDB:4zhxA	0.193	0.159	6.800E-2	409	0.057	0.046	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
19	PDB:2x4fA	0.190	0.220	7.618E-2	289	0.048	0.055	2x4fA.pdb.gz	The Crystal Structure of the Human Myosin Light Chain Kinase Loc340156
20	PDB:3uc4A	0.189	0.212	9.033E-2	295	0.062	0.071	3uc4A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q496M5	0.0	675	336	1.000	1.000	PLK5_HUMAN Inactive serine/threonine-protein kinase PLK5 OS=Homo sapiens OX=9606 GN=PLK5 PE=1 SV=4
2	Q4FZD7	4.10e-131	388	595	0.640	0.361	PLK5_MOUSE Inactive serine/threonine-protein kinase PLK5 OS=Mus musculus OX=10090 GN=Plk5 PE=1 SV=1
3	Q9H4B4	4.97e-44	162	646	0.381	0.198	PLK3_HUMAN Serine/threonine-protein kinase PLK3 OS=Homo sapiens OX=9606 GN=PLK3 PE=1 SV=2
4	Q60806	2.73e-43	159	631	0.375	0.200	PLK3_MOUSE Serine/threonine-protein kinase PLK3 OS=Mus musculus OX=10090 GN=Plk3 PE=1 SV=2
5	Q9R011	1.81e-42	157	647	0.381	0.198	PLK3_RAT Serine/threonine-protein kinase PLK3 OS=Rattus norvegicus OX=10116 GN=Plk3 PE=1 SV=2
6	P53351	6.55e-42	156	682	0.348	0.172	PLK2_MOUSE Serine/threonine-protein kinase PLK2 OS=Mus musculus OX=10090 GN=Plk2 PE=1 SV=1
7	Q9R012	8.90e-42	156	682	0.351	0.173	PLK2_RAT Serine/threonine-protein kinase PLK2 OS=Rattus norvegicus OX=10116 GN=Plk2 PE=1 SV=1
8	Q9NYY3	1.51e-41	155	685	0.354	0.174	PLK2_HUMAN Serine/threonine-protein kinase PLK2 OS=Homo sapiens OX=9606 GN=PLK2 PE=1 SV=3
9	A6H8T5	6.16e-35	136	657	0.339	0.174	A6H8T5_DANRE Serine/threonine-protein kinase PLK OS=Danio rerio OX=7955 GN=plk2 PE=2 SV=1
10	P70032	4.17e-27	114	598	0.307	0.172	PLK1_XENLA Serine/threonine-protein kinase PLK1 OS=Xenopus laevis OX=8355 GN=plk1 PE=1 SV=1
11	P53350	1.92e-24	106	603	0.321	0.179	PLK1_HUMAN Serine/threonine-protein kinase PLK1 OS=Homo sapiens OX=9606 GN=PLK1 PE=1 SV=1
12	Q07832	2.55e-24	105	603	0.315	0.176	PLK1_MOUSE Serine/threonine-protein kinase PLK1 OS=Mus musculus OX=10090 GN=Plk1 PE=1 SV=2
13	Q62673	4.57e-24	105	603	0.315	0.176	PLK1_RAT Serine/threonine-protein kinase PLK1 OS=Rattus norvegicus OX=10116 GN=Plk1 PE=2 SV=2
14	F7HSC1	1.37e-23	103	603	0.318	0.177	F7HSC1_MACMU Serine/threonine-protein kinase PLK OS=Macaca mulatta OX=9544 GN=PLK1 PE=3 SV=1
15	Q4KMI8	1.47e-22	100	595	0.283	0.160	Q4KMI8_DANRE Serine/threonine-protein kinase PLK OS=Danio rerio OX=7955 GN=ik:tdsubc_2d1 PE=1 SV=1
16	Q6DRK7	1.58e-22	100	595	0.286	0.161	Q6DRK7_DANRE Serine/threonine-protein kinase PLK OS=Danio rerio OX=7955 GN=plk1 PE=1 SV=1
17	P52304	1.14e-18	89.0	576	0.182	0.106	POLO_DROME Serine/threonine-protein kinase polo OS=Drosophila melanogaster OX=7227 GN=polo PE=1 SV=2
18	Q9N2L7	2.99e-17	84.7	632	0.220	0.117	PLK2_CAEEL Serine/threonine-protein kinase plk-2 OS=Caenorhabditis elegans OX=6239 GN=plk-2 PE=1 SV=1
19	P34331	1.93e-15	79.3	649	0.205	0.106	PLK1_CAEEL Serine/threonine-protein kinase plk-1 OS=Caenorhabditis elegans OX=6239 GN=plk-1 PE=1 SV=3
20	Q5ABG0	5.60e-12	68.9	653	0.208	0.107	Q5ABG0_CANAL Serine/threonine-protein kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CDC5 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00069 Pkinase	0.27	22.2	Protein kinase domain
2	PF00659 POLO_box	11	17.5	POLO box duplicated region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000466248

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000270861	0.756	Serine/threonine-protein kinase PLK4
2	9606.ENSP00000321656	0.753	M-phase inducer phosphatase 3
3	9606.ENSP00000430774	0.751	Uncharacterized protein
4	9606.ENSP00000378699	0.700	Cyclin-dependent kinase 1
5	9606.ENSP00000260731	0.673	Kinesin-like protein KIF11
6	9606.ENSP00000176763	0.641	Serine/threonine-protein kinase 10
7	9606.ENSP00000313950	0.623	Aurora kinase B
8	9606.ENSP00000349961	0.615	Structural maintenance of chromosomes protein 4
9	9606.ENSP00000216911	0.614	Aurora kinase A
10	9606.ENSP00000354720	0.597	Structural maintenance of chromosomes protein 3
11	9606.ENSP00000251472	0.596	Microtubule-associated serine/threonine-protein kinase 1
12	9606.ENSP00000265728	0.587	Protein DBF4 homolog A
13	9606.ENSP00000323663	0.587	Protein DBF4 homolog B
14	9606.ENSP00000296509	0.586	Mitotic spindle assembly checkpoint protein MAD2A
15	9606.ENSP00000372023	0.582	Serine/threonine-protein kinase Chk2
16	9606.ENSP00000402084	0.582	Wee1-like protein kinase
17	9606.ENSP00000302898	0.576	Aurora kinase C
18	9606.ENSP00000415430	0.573	G2 and S phase-expressed protein 1
19	9606.ENSP00000302530	0.560	Mitotic checkpoint serine/threonine-protein kinase BUB1
20	9606.ENSP00000353735	0.555	E3 ubiquitin-protein ligase Topors

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004672	1.000	protein kinase activity
GO:0004674	0.973	protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0010564	0.982	regulation of cell cycle process
GO:0051128	0.972	regulation of cellular component organization
GO:1901987	0.962	regulation of cell cycle phase transition
GO:0007346	0.961	regulation of mitotic cell cycle
GO:0048518	0.935	positive regulation of biological process
GO:0048522	0.929	positive regulation of cellular process
GO:1901990	0.928	regulation of mitotic cell cycle phase transition
GO:0050896	0.912	response to stimulus
GO:1902806	0.892	regulation of cell cycle G1/S phase transition
GO:0051130	0.864	positive regulation of cellular component organization
GO:0009987	0.832	cellular process
GO:0010941	0.807	regulation of cell death
GO:0010976	0.794	positive regulation of neuron projection development
GO:2000045	0.715	regulation of G1/S transition of mitotic cell cycle
GO:0006950	0.682	response to stress
GO:0070848	0.597	response to growth factor
GO:0006952	0.545	defense response
GO:0043067	0.519	regulation of programmed cell death
GO:0071363	0.463	cellular response to growth factor stimulus
GO:0009607	0.392	response to biotic stimulus
GO:0071704	0.338	organic substance metabolic process
GO:0043170	0.325	macromolecule metabolic process
GO:0044238	0.322	primary metabolic process
GO:0007049	0.317	cell cycle
GO:0006807	0.315	nitrogen compound metabolic process
GO:0022402	0.300	cell cycle process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0031981	0.967	nuclear lumen
GO:0043232	0.966	intracellular non-membrane-bounded organelle
GO:0005829	0.942	cytosol
GO:0005654	0.403	nucleoplasm
GO:0032991	0.354	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]