StarFunc result for job id Q49A26

User Input

>input (553 residues)
MAAVSLRLGDLVWGKLGRYPPWPGKIVNPPKDLKKPRGKKCFFVKFFGTEDHAWIKVEQL
KPYHAHKEEMIKINKGKRFQQAVDAVEEFLRRAKGKDQTSSHNSSDDKNRRNSSEERSRP
NSGDEKRKLSLSEGKVKKNMGEGKKRVSSGSSERGSKSPLKRAQEQSPRKRGRPPKDEKD
LTIPESSTVKGMMAGPMAAFKWQPTASEPVKDADPHFHHFLLSQTEKPAVCYQAITKKLK
ICEEETGSTSIQAADSTAVNGSITPTDKKIGFLGLGLMGSGIVSNLLKMGHTVTVWNRTA
EKCDLFIQEGARLGRTPAEVVSTCDITFACVSDPKAAKDLVLGPSGVLQGIRPGKCYVDM
STVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDCSSCFQAM
GKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAQVTGQSQQTLLDILNQGQLASI
FLDQKCQNILQGNFKPDFYLKYIQKDLRLAIALGDAVNHPTPMAAAANEVYKRAKALDQS
DNDMSAVYRAYIH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q49A26	1.000	1.000	9.372E-98	553	1.000	1.000	Q49A26.pdb.gz	GLYR1_HUMAN Cytokine-like nuclear factor N-PAC OS=Homo sapiens OX=9606 GN=GLYR1 PE=1 SV=4
2	AFDB:F4I907	0.520	0.798	5.049E-39	358	0.257	0.397	F4I907.pdb.gz	GLYR2_ARATH Glyoxylate/succinic semialdehyde reductase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GLYR2 PE=1 SV=1
3	AFDB:Q9LSV0	0.508	0.968	1.949E-37	289	0.253	0.484	Q9LSV0.pdb.gz	GLYR1_ARATH Glyoxylate/succinic semialdehyde reductase 1 OS=Arabidopsis thaliana OX=3702 GN=GLYR1 PE=1 SV=1
4	PDB:3dojA	0.514	0.967	1.458E-35	292	0.257	0.486	3dojA.pdb.gz
5	AFDB:Q9SZE1	0.503	0.822	6.526E-30	334	0.175	0.290	Q9SZE1.pdb.gz	3HID1_ARATH Probable 3-hydroxyisobutyrate dehydrogenase-like 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g29120 PE=1 SV=1
6	AFDB:Q0QLF5	0.495	0.888	2.909E-29	301	0.152	0.279	Q0QLF5.pdb.gz	HMGD_EUBBA 2-(hydroxymethyl)glutarate dehydrogenase OS=Eubacterium barkeri OX=1528 GN=Hgd PE=1 SV=1
7	AFDB:Q585Q3	0.506	0.922	7.879E-29	300	0.157	0.290	Q585Q3.pdb.gz	Q585Q3_TRYB2 2-hydroxy-3-oxopropionate reductase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.28P18.310 PE=4 SV=1
8	AFDB:P0ABQ2	0.502	0.932	1.618E-28	294	0.148	0.279	P0ABQ2.pdb.gz	GARR_ECOLI 2-hydroxy-3-oxopropionate reductase OS=Escherichia coli (strain K12) OX=83333 GN=garR PE=1 SV=1
9	PDB:3ckyA	0.471	0.836	5.451E-28	297	0.150	0.279	3ckyA.pdb.gz
10	AFDB:P77161	0.480	0.878	2.635E-26	292	0.141	0.267	P77161.pdb.gz	GLXR_ECOLI 2-hydroxy-3-oxopropionate reductase OS=Escherichia coli (strain K12) OX=83333 GN=glxR PE=2 SV=1
11	AFDB:P31937	0.492	0.797	3.882E-26	336	0.148	0.244	P31937.pdb.gz	3HIDH_HUMAN 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=HIBADH PE=1 SV=2
12	AFDB:Q9I5I6	0.489	0.883	3.438E-24	298	0.132	0.245	Q9I5I6.pdb.gz	SERDH_PSEAE NAD-dependent L-serine dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA0743 PE=1 SV=1
13	PDB:6smzC	0.359	0.646	5.163E-23	295	0.130	0.244	6smzC.pdb.gz	Dynamic Structural Changes Accompany the Production of Dihydroxypropanesulfonate by Sulfolactaldehyde Reductase
14	PDB:3obbA	0.485	0.883	2.717E-22	295	0.128	0.241	3obbA.pdb.gz	Biochemical and Structural Studies of Uncharacterized Protein PA0743 from Pseudomonas aeruginosa Revealed NAD+-dependent L-Serine Dehydrogenase.
15	PDB:2p4qA	0.351	0.403	6.824E-13	476	0.085	0.099	2p4qA.pdb.gz	Crystal structure of Saccharomyces cerevisiae 6-phosphogluconate dehydrogenase Gnd1
16	PDB:2jkvA	0.371	0.422	1.749E-12	482	0.087	0.100	2jkvA.pdb.gz	Structure of Human Phosphogluconate Dehydrogenase in Complex with Nadph at 2.53A
17	PDB:3fwnA	0.348	0.407	2.306E-12	467	0.105	0.124	3fwnA.pdb.gz	Conformational changes associated with cofactor/substrate binding of 6-phosphogluconate dehydrogenase from Escherichia coli and Klebsiella pneumoniae: Implications for enzyme mechanism
18	PDB:1pgjA	0.431	0.494	9.411E-11	478	0.087	0.100	1pgjA.pdb.gz
19	PDB:3khuB	0.369	0.429	7.297E-10	467	0.087	0.103	3khuB.pdb.gz	Structural and Kinetic Evidence That Catalytic Reaction of Human UDP-glucose 6-Dehydrogenase Involves Covalent Thiohemiacetal and Thioester Enzyme Intermediates.
20	PDB:4edfA	0.377	0.473	1.499E-9	431	0.083	0.107	4edfA.pdb.gz	Cofactor binding triggers a molecular switch to allosterically activate human UDP-{alpha}-D-glucose 6-dehydrogenase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	K7EMM8	0.0	1077	524	0.946	0.998	K7EMM8_HUMAN Cytokine-like nuclear factor N-PAC (Fragment) OS=Homo sapiens OX=9606 GN=GLYR1 PE=1 SV=2
2	Q49A26	0.0	1150	553	1.000	1.000	GLYR1_HUMAN Cytokine-like nuclear factor N-PAC OS=Homo sapiens OX=9606 GN=GLYR1 PE=1 SV=4
3	Q922P9	0.0	1113	546	0.975	0.987	GLYR1_MOUSE Cytokine-like nuclear factor N-PAC OS=Mus musculus OX=10090 GN=Glyr1 PE=1 SV=1
4	Q8T079	4.30e-94	301	602	0.344	0.316	GLYR1_DROME Cytokine-like nuclear factor N-PAC OS=Drosophila melanogaster OX=7227 GN=Ndf PE=1 SV=1
5	Q9LSV0	3.69e-88	275	289	0.253	0.484	GLYR1_ARATH Glyoxylate/succinic semialdehyde reductase 1 OS=Arabidopsis thaliana OX=3702 GN=GLYR1 PE=1 SV=1
6	F4I907	1.73e-82	263	358	0.237	0.366	GLYR2_ARATH Glyoxylate/succinic semialdehyde reductase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GLYR2 PE=1 SV=1
7	K7EQB2	3.36e-66	214	185	0.177	0.530	K7EQB2_HUMAN Glyoxylate reductase 1 homolog (Fragment) OS=Homo sapiens OX=9606 GN=GLYR1 PE=1 SV=8
8	Q9SZE1	5.60e-37	142	334	0.172	0.284	3HID1_ARATH Probable 3-hydroxyisobutyrate dehydrogenase-like 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g29120 PE=1 SV=1
9	P0ABQ2	8.38e-37	140	294	0.150	0.282	GARR_ECOLI 2-hydroxy-3-oxopropionate reductase OS=Escherichia coli (strain K12) OX=83333 GN=garR PE=1 SV=1
10	Q585Q3	1.60e-36	139	300	0.163	0.300	Q585Q3_TRYB2 2-hydroxy-3-oxopropionate reductase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.28P18.310 PE=4 SV=1
11	Q0QLF5	2.91e-34	133	301	0.152	0.279	HMGD_EUBBA 2-(hydroxymethyl)glutarate dehydrogenase OS=Eubacterium barkeri OX=1528 GN=Hgd PE=1 SV=1
12	Q9SUC0	1.62e-29	121	347	0.154	0.245	3HIDH_ARATH Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g20930 PE=1 SV=3
13	P77161	3.94e-26	110	292	0.141	0.267	GLXR_ECOLI 2-hydroxy-3-oxopropionate reductase OS=Escherichia coli (strain K12) OX=83333 GN=glxR PE=2 SV=1
14	Q99L13	1.08e-25	110	335	0.134	0.221	3HIDH_MOUSE 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Hibadh PE=1 SV=1
15	P0A9V8	2.08e-24	105	298	0.130	0.242	SQUU_ECOLI 3-sulfolactaldehyde reductase OS=Escherichia coli (strain K12) OX=83333 GN=yihU PE=1 SV=1
16	Q9V8M5	6.80e-23	102	324	0.143	0.244	3HIDH_DROME Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=CG15093 PE=2 SV=2
17	P31937	7.75e-23	102	336	0.134	0.220	3HIDH_HUMAN 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=HIBADH PE=1 SV=2
18	F4IAP5	1.40e-18	92.4	1393	0.121	0.048	F4IAP5_ARATH Ketose-bisphosphate aldolase class-II family protein OS=Arabidopsis thaliana OX=3702 GN=At1g18270 PE=1 SV=1
19	Q57WY0	6.47e-15	79.0	370	0.114	0.170	Q57WY0_TRYB2 Dehydrogenase-like protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.27F10.410 PE=4 SV=1
20	Q9I5I6	3.28e-14	75.9	298	0.132	0.245	SERDH_PSEAE NAD-dependent L-serine dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA0743 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02826 2-Hacid_dh_C	0.23	22.3	D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
2	PF02737 3HCDH_N	20	16.5	3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
3	PF02558 ApbA	0.79	20.8	Ketopantoate reductase PanE/ApbA
4	PF09193 CholecysA-Rec_N	5.8e+02	11.9	Cholecystokinin A receptor, N-terminal
5	PF03807 F420_oxidored	0.0006	31.7	NADP oxidoreductase coenzyme F420-dependent
6	PF14833 NAD_binding_11	6.3e-20	83.0	NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase
7	PF03446 NAD_binding_2	2.2e-35	133.7	NAD binding domain of 6-phosphogluconate dehydrogenase
8	PF01210 NAD_Gly3P_dh_N	5.4e+02	12.0	NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus
9	PF00855 PWWP	2.6e-15	68.0	PWWP domain
10	PF03435 Sacchrp_dh_NADP	1.2e+02	14.4	Saccharopine dehydrogenase NADP binding domain
11	PF01488 Shikimate_DH	0.92	21.0	Shikimate / quinate 5-dehydrogenase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000322716

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000297792	0.928	Lysine-specific histone demethylase 1B
2	9606.ENSP00000229270	0.795	Triosephosphate isomerase 1
3	9606.ENSP00000450436	0.754	Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial
4	9606.ENSP00000216254	0.722	Aconitate hydratase, mitochondrial
5	9606.ENSP00000328484	0.714	Histone H2A type 1-J
6	9606.ENSP00000370109	0.712	PC4 and SFRS1-interacting protein
7	9606.ENSP00000417404	0.709	Hereditary hemochromatosis protein
8	9606.ENSP00000373340	0.689	Peregrin
9	9606.ENSP00000245206	0.685	Aspartate aminotransferase, mitochondrial
10	9606.ENSP00000263080	0.671	Aspartoacylase
11	9606.ENSP00000354730	0.669	Chromosome alignment-maintaining phosphoprotein 1
12	9606.ENSP00000373696	0.660	E3 ubiquitin-protein ligase TRIP12
13	9606.ENSP00000468348	0.649	Dual specificity mitogen-activated protein kinase kinase 6
14	9606.ENSP00000307208	0.626	Nucleosome-remodeling factor subunit BPTF
15	9606.ENSP00000383042	0.600	Lysine-specific histone demethylase 1A
16	9606.ENSP00000355778	0.593	Histone H3.3
17	9606.ENSP00000254810	0.580	H3 histone, family 3B (H3.3B)
18	9606.ENSP00000373347	0.560	SLIT-ROBO Rho GTPase-activating protein 3
19	9606.ENSP00000314649	0.558	Succinate-semialdehyde dehydrogenase, mitochondrial
20	9606.ENSP00000450461	0.541	Centrosomal protein 95

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003682	1.000	chromatin binding
GO:0003677	1.000	DNA binding
GO:0003824	0.989	catalytic activity
GO:0042393	0.988	histone binding
GO:0031491	0.950	nucleosome binding
GO:0035064	0.950	methylated histone binding
GO:0016491	0.391	oxidoreductase activity
GO:0016616	0.316	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.981	regulation of cellular process
GO:1901983	0.909	regulation of protein acetylation
GO:0031401	0.895	positive regulation of protein modification process
GO:0031056	0.842	regulation of histone modification
GO:0031323	0.841	regulation of cellular metabolic process
GO:0019219	0.808	regulation of nucleobase-containing compound metabolic process
GO:1901985	0.802	positive regulation of protein acetylation
GO:0048522	0.800	positive regulation of cellular process
GO:2000756	0.795	regulation of peptidyl-lysine acetylation
GO:0031058	0.787	positive regulation of histone modification
GO:0006357	0.780	regulation of transcription by RNA polymerase II
GO:2000758	0.752	positive regulation of peptidyl-lysine acetylation
GO:0035065	0.738	regulation of histone acetylation
GO:0009987	0.721	cellular process
GO:0031328	0.670	positive regulation of cellular biosynthetic process
GO:0010557	0.653	positive regulation of macromolecule biosynthetic process
GO:0045935	0.627	positive regulation of nucleobase-containing compound metabolic process
GO:1902680	0.605	positive regulation of RNA biosynthetic process
GO:0008152	0.534	metabolic process
GO:0045893	0.534	positive regulation of DNA-templated transcription
GO:0071704	0.521	organic substance metabolic process
GO:0045944	0.389	positive regulation of transcription by RNA polymerase II
GO:0044237	0.317	cellular metabolic process
GO:0006807	0.303	nitrogen compound metabolic process
GO:0044238	0.302	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0043232	0.990	intracellular non-membrane-bounded organelle
GO:0032991	0.989	protein-containing complex
GO:0005694	0.831	chromosome
GO:0000785	0.752	chromatin
GO:0000786	0.512	nucleosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.391	Oxidoreductases.
EC:1.1.1.-	0.316	With NAD(+) or NADP(+) as acceptor.

[back to server]