StarFunc result for job id Q49AJ0

User Input

>input (1406 residues)
MSEIQGTVEFSVELHKFYNVDLFQRGYYQIRVTLKVSSRIPHRLSASIAGQTESSSLHSA
CVHDSTVHSRVFQILYRNEEVPINDAVVFRVHLLLGGERMEDALSEVDFQLKVDLHFTDS
EQQLRDVAGAPMVSSRTLGLHFHPRNGLHHQVPVMFDYFHLSVISVTVHAALVALQQPLI
SFTRPGRGSWLGKGGPDTGQEQSIISLENLVFGAGYCKPTSSEGSFYITSENCMQHAHKW
HRDLCLLLLHAYRGLRLHFLVIMRDIPELPHTELEALAVEETLSQLCSELQMLNNPEKIA
EQISKDLAWLTSHMMTLWTQFLDTVTLHSQVTTYLTQEHHTLRVRRFSEAFFYMEHQKLA
VLTFQENLIQTHSQLSLDIRNSEYLTSMPPLPAECLDIDGDWNTLPVIFEDRYVDCPATG
HNLSVYPNFDVPVTSPTIMNLKDKEDNCMVNSNLSFREDLVLSTIKPSQMDSDEEVIRCP
EPGENVATQNHMDMCSESQVYISIGEFQNKAGVPEDECWTGQTSDAGTYPVADVDTSRRS
PGPEDGQAPVLTYIDVKSSNKNPSRAEPLVAFNAQHESRSSRDKYGLDRTGLSKVVVGGS
HQNAISSDKTTLHELSTLGKGIDQEGKMVLLSLKLTPSEPCDPLSSTLREPLDIRSSLKD
SHTEEQEELSVLSGVIKRSSSIISDSGIESEPSSVAWSEARSRALELPSDREVLHPFVRR
HALHRNSLEGGHTESNTSLPSGIQASLTSISSLPFEEDEREVALTKLTKSVSAPHISSPE
EAAEDADTKQQDGGFAEPSDMHSKSQGSPGSCSQLCGDSGTDAGADHPLVEIVLDADNQQ
GPGYIDIPKGKGKQFDAQGHCLPDGRTENTPGVETKGLNLKIPRVIALENPRTRSLHRAL
EETPKGMPKDLNVGQQALSNSGISEVEGLSQHQVPELSCTSAADAINRNSTGQQSQSGSP
CIMDDTAFNRGVNAFPEAKHKAGTVCPTVTHSVHSQVLKNQELKAGTSIMGSHLTSAETF
TLDSLKAVEVVNLSVSCTATCLPFSSVPKETPARAGFSSKQTLFPITHQPLGSFGVVSTH
SSTLDEEVSERMFSFYQAKEKFKKELKIEGFLYSDLTVLASDIPYFPPEEEEENLEDGIH
LVVCVHGLDGNSADLRLVKTFIELGLPGGKLDFLMSEKNQMDTFADFDTMTDRLLDEIIQ
HIQLYNLSISRISFIGHSLGNIIIRSVLTRPRFRYYLNKLHTFLSLSGPHLGTLYNNSTL
VSTGLWLMQKLKKSGSLLQLTFRDNADLRKCFLYQLSQKTGLQYFKNVVLVASPQDRYVP
FHSARIEMCKTALKDRHTGPVYAEMINNLLGPLVEAKDCTLIRHNVFHALPNTANTLIGR
AAHIAVLDSELFLEKFFLVAGLNYFK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q49AJ0	1.000	1.000	0.000	1406	1.000	1.000	Q49AJ0.pdb.gz	F135B_HUMAN Protein FAM135B OS=Homo sapiens OX=9606 GN=FAM135B PE=1 SV=2
2	PDB:1exwA	0.130	0.552	2.979E-6	279	0.031	0.158	1exwA.pdb.gz	Structural basis for the insensitivity of a serine enzyme (palmitoyl-protein thioesterase) to phenylmethylsulfonyl fluoride.
3	PDB:4e15B	0.117	0.417	4.148E-5	303	0.027	0.125	4e15B.pdb.gz
4	PDB:6ap6A	0.106	0.426	4.359E-5	264	0.028	0.148	6ap6A.pdb.gz	Inhibition of strigolactone receptors byN-phenylanthranilic acid derivatives: Structural and functional insights.
5	PDB:1vkhA	0.103	0.435	1.178E-4	261	0.026	0.138	1vkhA.pdb.gz
6	PDB:6eicB	0.106	0.427	2.741E-4	279	0.026	0.129	6eicB.pdb.gz
7	AFDB:A0A5F8MPU3	0.078	0.052	3.611E-4	2282	0.104	0.064	A0A5F8MPU3.pdb.gz	CTSRT_MOUSE Cation channel sperm-associated targeting subunit tau OS=Mus musculus OX=10090 GN=C2cd6 PE=1 SV=1
8	PDB:4htaA	0.100	0.373	4.078E-4	271	0.028	0.144	4htaA.pdb.gz
9	PDB:7lq1A	0.071	0.102	4.286E-4	950	0.038	0.057	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
10	PDB:4zwnB	0.104	0.357	5.228E-4	311	0.030	0.135	4zwnB.pdb.gz
11	PDB:1ex9A	0.099	0.381	6.703E-4	285	0.031	0.154	1ex9A.pdb.gz	Crystal structure of pseudomonas aeruginosa lipase in the open conformation. The prototype for family I.1 of bacterial lipases.
12	PDB:6fvjD	0.096	0.438	6.703E-4	223	0.019	0.121	6fvjD.pdb.gz	Biochemical and Structural Characterization of TesA, a Major Thioesterase Required for Outer-Envelope Lipid Biosynthesis in Mycobacterium tuberculosis.
13	AFDB:Q8N3D4	0.091	0.084	7.996E-4	1523	0.097	0.089	Q8N3D4.pdb.gz	EH1L1_HUMAN EH domain-binding protein 1-like protein 1 OS=Homo sapiens OX=9606 GN=EHBP1L1 PE=1 SV=2
14	AFDB:Q8T498	0.082	0.074	3.321E-2	1580	0.112	0.100	Q8T498.pdb.gz	GAP2_DROME Ras GTPase-activating protein raskol OS=Drosophila melanogaster OX=7227 GN=raskol PE=1 SV=3
15	AFDB:Q9V9S7	0.064	0.051	8.537E-2	1866	0.113	0.085	Q9V9S7.pdb.gz	SYDE_DROME Rho GTPase-activating protein 100F OS=Drosophila melanogaster OX=7227 GN=RhoGAP100F PE=1 SV=2
16	AFDB:E7F1U4	0.062	0.058	1.150E-1	1507	0.102	0.096	E7F1U4.pdb.gz	E7F1U4_DANRE Ras/Rap GTPase-activating protein SynGAP1b OS=Danio rerio OX=7955 GN=si:dkey-246f6.1 PE=1 SV=4
17	AFDB:Q63803	0.051	0.057	1.712E-1	1144	0.114	0.140	Q63803.pdb.gz	GNAS1_RAT Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas OS=Rattus norvegicus OX=10116 GN=Gnas PE=1 SV=3
18	AFDB:Q6S002	0.037	0.041	1.712E-1	1238	0.070	0.079	Q6S002.pdb.gz	KIF10_DICDI Kinesin-related protein 10 OS=Dictyostelium discoideum OX=44689 GN=kif10 PE=3 SV=1
19	AFDB:E9QHX3	0.066	0.074	2.194E-1	1246	0.095	0.108	E9QHX3.pdb.gz
20	AFDB:A0A0B4K822	0.034	0.041	2.547E-1	1136	0.083	0.103	A0A0B4K822.pdb.gz	A0A0B4K822_DROME Missing-in-metastasis, isoform H OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q49AJ0	0.0	2912	1406	1.000	1.000	F135B_HUMAN Protein FAM135B OS=Homo sapiens OX=9606 GN=FAM135B PE=1 SV=2
2	Q08448	4.99e-07	56.2	450	0.038	0.120	LPL1_YEAST Lipid droplet phospholipase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LPL1 PE=1 SV=1
3	P53118	2.12e-04	48.1	685	0.031	0.063	ROG1_YEAST Putative lipase ROG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ROG1 PE=1 SV=1
4	Q147P6	5.60e-04	46.6	418	0.020	0.067	Q147P6_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At4g25770 PE=1 SV=1
5	F4HZW3	0.002	45.1	456	0.021	0.066	F4HZW3_ARATH Hydrolase-like protein family OS=Arabidopsis thaliana OX=3702 GN=UP9 PE=1 SV=1
6	Q0WSU9	1.7	35.4	479	0.019	0.056	Q0WSU9_ARATH At5g50330 OS=Arabidopsis thaliana OX=3702 GN=MXI22.4 PE=1 SV=1
7	F4JRQ4	2.2	35.0	481	0.028	0.081	F4JRQ4_ARATH Protein kinase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At4g24810 PE=1 SV=1
8	T2G6Z9	2.3	35.0	666	0.014	0.029	APRA_MEGG1 Adenylylsulfate reductase subunit alpha OS=Megalodesulfovibrio gigas (strain ATCC 19364 / DSM 1382 / NCIMB 9332 / VKM B-1759) OX=1121448 GN=aprA PE=1 SV=1
9	Q0P8J6	2.4	35.0	779	0.018	0.032	GLKIN_CAMJE L-glutamine kinase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=Cj1418c PE=1 SV=1
10	Q8WZK0	2.6	35.0	695	0.018	0.036	US107_SCHPO U1 snRNP-associated protein usp107 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=usp107 PE=1 SV=1
11	E9Q7D5	4.1	34.3	1581	0.020	0.018	ARHG5_MOUSE Rho guanine nucleotide exchange factor 5 OS=Mus musculus OX=10090 GN=Arhgef5 PE=1 SV=1
12	P56657	4.5	33.9	491	0.021	0.059	CP240_MOUSE Cytochrome P450 2C40 OS=Mus musculus OX=10090 GN=Cyp2c40 PE=1 SV=2
13	O94645	4.9	33.5	239	0.023	0.134	YBV3_SCHPO Uncharacterized protein C21.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC21.03c PE=4 SV=3
14	Q09103	8.0	33.5	1457	0.011	0.010	DGK2_DROME Eye-specific diacylglycerol kinase OS=Drosophila melanogaster OX=7227 GN=rdgA PE=2 SV=2
15	Q96B18	8.1	33.1	629	0.016	0.037	DACT3_HUMAN Dapper homolog 3 OS=Homo sapiens OX=9606 GN=DACT3 PE=1 SV=2
16	A0A1D8PMK0	8.7	33.1	917	0.021	0.032	A0A1D8PMK0_CANAL Ago1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=AGO1 PE=3 SV=1
17	Q71DJ5	9.6	32.7	393	0.012	0.043	LIP1_ARATH Triacylglycerol lipase 1 OS=Arabidopsis thaliana OX=3702 GN=LIP1 PE=1 SV=1
18	Q9ERH6	9.8	32.7	352	0.014	0.057	MOAP1_MOUSE Modulator of apoptosis 1 OS=Mus musculus OX=10090 GN=Moap1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12394 DUF3657	1.5e-12	59.2	Protein FAM135
2	PF05057 DUF676	1.1e-53	193.6	Putative serine esterase (DUF676)
3	PF02450 LCAT	25	15.5	Lecithin:cholesterol acyltransferase
4	PF02089 Palm_thioest	1.5e-05	36.4	Palmitoyl protein thioesterase
5	PF07819 PGAP1	0.028	25.7	PGAP1-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378710

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354163	0.721	Protein FAM110A
2	9606.ENSP00000259154	0.713	BTB/POZ domain-containing protein KCTD3
3	9606.ENSP00000484862	0.688	Disintegrin and metalloproteinase domain-containing protein 29
4	9606.ENSP00000408581	0.672	Transmembrane protein 132D
5	9606.ENSP00000359634	0.664	Golgin subfamily A member 7B
6	9606.ENSP00000428540	0.617	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1
7	9606.ENSP00000403397	0.615	Palmitoyltransferase ZDHHC17
8	9606.ENSP00000216185	0.583	Thioredoxin, mitochondrial
9	9606.ENSP00000330199	0.562	Sodium-dependent neutral amino acid transporter SLC6A17
10	9606.ENSP00000371985	0.560	Potassium voltage-gated channel subfamily A member 1
11	9606.ENSP00000363257	0.553	Palmitoyltransferase ZDHHC18
12	9606.ENSP00000331397	0.541	Protein FAM43B
13	9606.ENSP00000380271	0.540	Rap guanine nucleotide exchange factor 4
14	9606.ENSP00000269394	0.538	Zinc finger protein 750
15	9606.ENSP00000348538	0.514	RNA-binding protein 38
16	9606.ENSP00000430269	0.514	Bifunctional epoxide hydrolase 2
17	9606.ENSP00000385118	0.510	Protein Largen
18	9606.ENSP00000272641	0.504	Neurexophilin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.857	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0065007	0.820	biological regulation
GO:0050789	0.787	regulation of biological process
GO:0050794	0.670	regulation of cellular process
GO:0008152	0.421	metabolic process
GO:0071704	0.347	organic substance metabolic process
GO:0071840	0.322	cellular component organization or biogenesis
GO:0044238	0.322	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	1.000	intracellular anatomical structure
GO:0043227	0.999	membrane-bounded organelle
GO:0043229	0.978	intracellular organelle
GO:0005737	0.972	cytoplasm
GO:0016020	0.857	membrane
GO:0043231	0.630	intracellular membrane-bounded organelle
GO:0042995	0.410	cell projection
GO:0120025	0.347	plasma membrane bounded cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]