StarFunc result for job id Q49AM1

User Input

>input (385 residues)
MLWKLLLRSQSCRLCSFRKMRSPPKYRPFLACFTYTTDKQSSKENTRTVEKLYKCSVDIR
KIRRLKGWVLLEDETYVEEIANILQELGADETAVASILERCPEAIVCSPTAVNTQRKLWQ
LVCKNEEELIKLIEQFPESFFTIKDQENQKLNVQFFQELGLKNVVISRLLTAAPNVFHNP
VEKNKQMVRILQESYLDVGGSEANMKVWLLKLLSQNPFILLNSPTAIKETLEFLQEQGFT
SFEILQLLSKLKGFLFQLCPRSIQNSISFSKNAFKCTDHDLKQLVLKCPALLYYSVPVLE
ERMQGLLREGISIAQIRETPMVLELTPQIVQYRIRKLNSSGYRIKDGHLANLNGSKKEFE
ANFGKIQAKKVRPLFNPVAPLNVEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q49AM1	1.000	1.000	1.517E-50	385	1.000	1.000	Q49AM1.pdb.gz	MTEF2_HUMAN Transcription termination factor 2, mitochondrial OS=Homo sapiens OX=9606 GN=MTERF2 PE=1 SV=2
2	AFDB:Q8BKY8	0.894	0.894	1.264E-38	385	0.764	0.764	Q8BKY8.pdb.gz	MTEF2_MOUSE Transcription termination factor 2, mitochondrial OS=Mus musculus OX=10090 GN=Mterf2 PE=1 SV=1
3	AFDB:Q99551	0.685	0.665	1.947E-18	399	0.257	0.248	Q99551.pdb.gz	MTEF1_HUMAN Transcription termination factor 1, mitochondrial OS=Homo sapiens OX=9606 GN=MTERF1 PE=1 SV=1
4	AFDB:B9EJ57	0.661	0.669	5.399E-18	379	0.242	0.245	B9EJ57.pdb.gz	MTF1B_MOUSE Transcription termination factor 1b, mitochondrial OS=Mus musculus OX=10090 GN=Mterf1b PE=2 SV=1
5	AFDB:B6TGN4	0.462	0.369	3.424E-9	494	0.192	0.150	B6TGN4.pdb.gz	MTEF4_MAIZE Transcription termination factor MTERF4, chloroplastic OS=Zea mays OX=4577 GN=MTERF4 PE=2 SV=1
6	AFDB:Q9ZT96	0.575	0.434	4.810E-9	541	0.161	0.115	Q9ZT96.pdb.gz	MTEF4_ARATH Transcription termination factor MTERF4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MTERF4 PE=1 SV=1
7	AFDB:Q9FM80	0.569	0.459	3.119E-8	496	0.145	0.113	Q9FM80.pdb.gz	MTEF9_ARATH Transcription termination factor MTERF9, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MTERF9 PE=2 SV=1
8	AFDB:F4IHL3	0.518	0.338	6.423E-8	641	0.174	0.105	F4IHL3.pdb.gz	MTEF2_ARATH Transcription termination factor MTERF2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MTERF2 PE=3 SV=1
9	AFDB:Q9C6A1	0.323	0.290	7.297E-8	445	0.171	0.148	Q9C6A1.pdb.gz	MTEFE_ARATH Transcription termination factor MTERF15, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MTERF15 PE=2 SV=1
10	AFDB:F4JSY9	0.568	0.576	1.116E-7	378	0.164	0.167	F4JSY9.pdb.gz	F4JSY9_ARATH Mitochondrial transcription termination factor family protein OS=Arabidopsis thaliana OX=3702 GN=PDE191 PE=1 SV=1
11	PDB:7pd3y	0.379	0.560	3.894E-4	245	0.106	0.167	7pd3y.pdb.gz	Visualizing formation of the active site in the mitochondrial ribosome.
12	PDB:4mc8A	0.104	0.123	5.339E-1	296	0.104	0.135	4mc8A.pdb.gz
13	PDB:5lkhA	0.137	0.085	9.275E-1	948	0.086	0.035	5lkhA.pdb.gz
14	PDB:5zlfA	0.105	0.126	9.678E-1	293	0.106	0.140	5zlfA.pdb.gz	Discovery of Lipophilic Bisphosphonates That Target Bacterial Cell Wall and Quinone Biosynthesis.
15	PDB:7zs9M	0.116	0.122	1.754	310	0.106	0.132	7zs9M.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
16	PDB:5kpv33	0.106	0.075	1.910	675	0.081	0.046	5kpv33.pdb.gz	Ribosome•RelA structures reveal the mechanism of stringent response activation.
17	PDB:6qumA	0.087	0.067	1.910	578	0.065	0.043	6qumA.pdb.gz	Structure and conformational plasticity of the intact Thermus thermophilus V/A-type ATPase.
18	PDB:5u1dA	0.108	0.084	2.572	561	0.099	0.068	5u1dA.pdb.gz
19	PDB:1n1zA	0.110	0.091	2.683	537	0.117	0.084	1n1zA.pdb.gz	Bornyl diphosphate synthase: Structure and strategy for carbocation manipulation by a terpenoid cyclase
20	PDB:1tr2B	0.117	0.062	2.921	1029	0.122	0.046	1tr2B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q49AM1	0.0	785	385	1.000	1.000	MTEF2_HUMAN Transcription termination factor 2, mitochondrial OS=Homo sapiens OX=9606 GN=MTERF2 PE=1 SV=2
2	Q8BKY8	0.0	603	385	0.764	0.764	MTEF2_MOUSE Transcription termination factor 2, mitochondrial OS=Mus musculus OX=10090 GN=Mterf2 PE=1 SV=1
3	Q8CHZ9	1.07e-38	144	379	0.260	0.264	MTF1A_MOUSE Transcription termination factor 1a, mitochondrial OS=Mus musculus OX=10090 GN=Mterf1a PE=2 SV=1
4	B9EJ57	2.15e-37	140	379	0.247	0.251	MTF1B_MOUSE Transcription termination factor 1b, mitochondrial OS=Mus musculus OX=10090 GN=Mterf1b PE=2 SV=1
5	B4DPR9	3.52e-37	140	379	0.255	0.259	B4DPR9_HUMAN Mitochondrial transcription termination factor 1 OS=Homo sapiens OX=9606 GN=MTERF1 PE=1 SV=1
6	Q99551	6.03e-37	140	399	0.255	0.246	MTEF1_HUMAN Transcription termination factor 1, mitochondrial OS=Homo sapiens OX=9606 GN=MTERF1 PE=1 SV=1
7	F4IHL3	5.31e-08	57.0	641	0.164	0.098	MTEF2_ARATH Transcription termination factor MTERF2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MTERF2 PE=3 SV=1
8	C9JNM8	0.009	38.5	139	0.065	0.180	C9JNM8_HUMAN Mitochondrial transcription termination factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=MTERF1 PE=1 SV=1
9	F4JVI3	0.010	40.4	493	0.114	0.089	MTEF5_ARATH Transcription termination factor MTERF5, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MTERF5 PE=1 SV=1
10	C9JE25	0.017	38.1	158	0.065	0.158	C9JE25_HUMAN Mitochondrial transcription termination factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=MTERF1 PE=1 SV=1
11	Q0WRV2	0.25	35.8	591	0.117	0.076	Q0WRV2_ARATH Mitochondrial transcription termination factor family protein OS=Arabidopsis thaliana OX=3702 GN=MTERF16 PE=1 SV=1
12	Q9ZT96	0.44	35.0	541	0.081	0.057	MTEF4_ARATH Transcription termination factor MTERF4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MTERF4 PE=1 SV=1
13	Q9FG25	0.59	35.0	1141	0.047	0.016	Q9FG25_ARATH Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=At5g06811 PE=3 SV=1
14	Q84X53	0.78	33.9	284	0.096	0.130	MTEF1_ARATH Transcription termination factor MTEF1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MTERF1 PE=2 SV=2
15	Q8R3J4	1.2	33.5	412	0.138	0.129	MTEF3_MOUSE Transcription termination factor 3, mitochondrial OS=Mus musculus OX=10090 GN=Mterf3 PE=2 SV=1
16	P58180	6.0	31.2	307	0.068	0.085	OR4D2_HUMAN Olfactory receptor 4D2 OS=Homo sapiens OX=9606 GN=OR4D2 PE=2 SV=1
17	Q9Y7J1	7.8	31.2	474	0.078	0.063	SPO6_SCHPO Sporulation-specific protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spo6 PE=4 SV=1
18	P0AEZ1	9.9	30.4	296	0.075	0.098	METF_ECOLI 5,10-methylenetetrahydrofolate reductase OS=Escherichia coli (strain K12) OX=83333 GN=metF PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02536 mTERF	2.7e-23	94.0	mTERF
2	PF06878 Pkip-1	1.2e+02	14.2	Pkip-1 protein
3	PF12614 RRF_GI	7.2e+02	11.7	Ribosome recycling factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000447651

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000287025	0.929	Transcription termination factor 3, mitochondrial
2	9606.ENSP00000480378	0.808	Transcription termination factor 4, mitochondrial
3	9606.ENSP00000355471	0.686	Dimethyladenosine transferase 2, mitochondrial
4	9606.ENSP00000419740	0.672	5-methylcytosine rRNA methyltransferase NSUN4
5	9606.ENSP00000356134	0.643	Dimethyladenosine transferase 1, mitochondrial
6	9606.ENSP00000370826	0.628	Lysine-specific demethylase hairless
7	9606.ENSP00000465759	0.611	DNA-directed RNA polymerase, mitochondrial
8	9606.ENSP00000442563	0.608	DNA polymerase subunit gamma-2, mitochondrial
9	9606.ENSP00000336724	0.556	TBC1 domain family member 22A
10	9606.ENSP00000462963	0.543	Transcription elongation factor, mitochondrial
11	9606.ENSP00000297313	0.539	Regulator of G-protein signaling 20
12	9606.ENSP00000400168	0.537	ATP5J2-PTCD1 readthrough
13	9606.ENSP00000442336	0.530	DNA topoisomerase 3-alpha
14	9606.ENSP00000333837	0.529	39S ribosomal protein L12, mitochondrial
15	9606.ENSP00000360858	0.523	Noelin
16	9606.ENSP00000370194	0.520	GDP-mannose 4,6 dehydratase
17	9606.ENSP00000228865	0.501	cAMP-responsive element-binding protein-like 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	1.000	DNA binding
GO:0003723	0.868	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0090304	0.996	nucleic acid metabolic process
GO:0034654	0.996	nucleobase-containing compound biosynthetic process
GO:0009059	0.995	macromolecule biosynthetic process
GO:0006351	0.994	DNA-templated transcription
GO:0140053	0.933	mitochondrial gene expression
GO:0000959	0.852	mitochondrial RNA metabolic process
GO:0071840	0.634	cellular component organization or biogenesis
GO:0050789	0.547	regulation of biological process
GO:0050794	0.538	regulation of cellular process
GO:0019222	0.516	regulation of metabolic process
GO:0016043	0.485	cellular component organization
GO:0006996	0.455	organelle organization
GO:0060255	0.428	regulation of macromolecule metabolic process
GO:0080090	0.333	regulation of primary metabolic process
GO:0051171	0.332	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.955	intracellular organelle lumen
GO:0043232	0.882	intracellular non-membrane-bounded organelle
GO:0005759	0.716	mitochondrial matrix
GO:0042645	0.713	mitochondrial nucleoid
GO:0031981	0.353	nuclear lumen
GO:0005654	0.324	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]