StarFunc result for job id Q49MG5

User Input

>input (647 residues)
MSDEVFSTTLAYTKSPKVTKRTTFQDELIRAITARSARQRSSEYSDDFDSDEIVSLGDFS
DTSADENSVNKKMNDFHISDDEEKNPSKLLFLKTNKSNGNITKDEPVCAIKNEEEMAPDG
CEDIVVKSFSESQNKDEEFEKDKIKMKPKPRILSIKSTSSAENNSLDTDDHFKPSPRPRS
MLKKKSHMEEKDGLEDKETALSEELELHSAPSSLPTPNGIQLEAEKKAFSENLDPEDSCL
TSLASSSLKQILGDSFSPGSEGNASGKDPNEEITENHNSLKSDENKENSFSADHVTTAVE
KSKESQVTADDLEEEKAKAELIMDDDRTVDPLLSKSQSILISTSATASSKKTIEDRNIKN
KKSTNNRASSASARLMTSEFLKKSSSKRRTPSTTTSSHYLGTLKVLDQKPSQKQSIEPDR
ADNIRAAVYQEWLEKKNVYLHEMHRIKRIESENLRIQNEQKKAAKREEALASFEAWKAMK
EKEAKKIAAKKRLEEKNKKKTEEENAARKGEALQAFEKWKEKKMEYLKEKNRKEREYERA
KKQKEEETVAEKKKDNLTAVEKWNEKKEAFFKQKEKEKINEKRKEELKRAEKKDKDKQAI
NEYEKWLENKEKQERIERKQKKRHSFLESEALPPWSPPSRTVFAKVF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q49MG5	0.999	0.999	9.378E-83	647	1.000	1.000	Q49MG5.pdb.gz	MAP9_HUMAN Microtubule-associated protein 9 OS=Homo sapiens OX=9606 GN=MAP9 PE=1 SV=3
2	AFDB:D3ZAG3	0.349	0.349	2.717E-52	646	0.705	0.706	D3ZAG3.pdb.gz	D3ZAG3_RAT Microtubule-associated protein 9 OS=Rattus norvegicus OX=10116 GN=Map9 PE=1 SV=1
3	AFDB:A0A2R8Q781	0.255	0.245	1.880E-17	678	0.304	0.291	A0A2R8Q781.pdb.gz
4	AFDB:P53352	0.223	0.174	1.018E-4	877	0.202	0.149	P53352.pdb.gz	INCE_CHICK Inner centromere protein OS=Gallus gallus OX=9031 GN=INCENP PE=1 SV=1
5	AFDB:Q9NQS7	0.198	0.148	3.654E-4	918	0.181	0.127	Q9NQS7.pdb.gz	INCE_HUMAN Inner centromere protein OS=Homo sapiens OX=9606 GN=INCENP PE=1 SV=3
6	AFDB:Q55AX2	0.246	0.097	1.222E-3	1845	0.195	0.068	Q55AX2.pdb.gz	DOT1L_DICDI Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Dictyostelium discoideum OX=44689 GN=dotA PE=2 SV=2
7	AFDB:Q8K1Q4	0.222	0.206	6.253E-3	703	0.133	0.122	Q8K1Q4.pdb.gz	LZTS3_RAT Leucine zipper putative tumor suppressor 3 OS=Rattus norvegicus OX=10116 GN=Lzts3 PE=1 SV=2
8	AFDB:F4HQB9	0.180	0.122	1.103E-2	976	0.156	0.103	F4HQB9.pdb.gz	F4HQB9_ARATH Golgin Putative 5 OS=Arabidopsis thaliana OX=3702 GN=GC5 PE=1 SV=1
9	AFDB:Q9SU08	0.215	0.162	1.814E-2	904	0.179	0.128	Q9SU08.pdb.gz	AUXI1_ARATH Auxilin-related protein 1 OS=Arabidopsis thaliana OX=3702 GN=AUXI1 PE=1 SV=2
10	AFDB:A6H5Y1	0.190	0.134	2.586E-2	991	0.161	0.105	A6H5Y1.pdb.gz	MPP9_MOUSE M-phase phosphoprotein 9 OS=Mus musculus OX=10090 GN=Mphosph9 PE=2 SV=2
11	PDB:1qb3B	0.041	0.184	5.627	119	0.014	0.076	1qb3B.pdb.gz
12	PDB:6u424R	0.121	0.199	9.930	366	0.073	0.128	6u424R.pdb.gz	Structure of the Decorated Ciliary Doublet Microtubule.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZAG3	0.0	751	646	0.699	0.700	D3ZAG3_RAT Microtubule-associated protein 9 OS=Rattus norvegicus OX=10116 GN=Map9 PE=1 SV=1
2	Q3TRR0	0.0	785	646	0.699	0.700	MAP9_MOUSE Microtubule-associated protein 9 OS=Mus musculus OX=10090 GN=Map9 PE=1 SV=2
3	Q49MG5	0.0	1296	647	1.000	1.000	MAP9_HUMAN Microtubule-associated protein 9 OS=Homo sapiens OX=9606 GN=MAP9 PE=1 SV=3
4	M9P175	4.91e-24	109	678	0.142	0.136	M9P175_DANRE Microtubule-associated protein 9 OS=Danio rerio OX=7955 GN=Map9 PE=2 SV=1
5	Q96HJ3	0.65	35.4	373	0.083	0.145	CCD34_HUMAN Coiled-coil domain-containing protein 34 OS=Homo sapiens OX=9606 GN=CCDC34 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000310593

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000286544	0.770	Protein FAM161B
2	9606.ENSP00000248437	0.721	Tubulin alpha-4A chain
3	9606.ENSP00000318086	0.708	MAP7 domain-containing protein 3
4	9606.ENSP00000396421	0.619	NXPE family member 3
5	9606.ENSP00000482335	0.592	Ensconsin
6	9606.ENSP00000326550	0.575	Transforming acidic coiled-coil-containing protein 3
7	9606.ENSP00000216911	0.570	Aurora kinase A
8	9606.ENSP00000368964	0.552	MAP7 domain containing 2
9	9606.ENSP00000451211	0.535	Protein NEDD1
10	9606.ENSP00000362244	0.516	MAP7 domain containing 1
11	9606.ENSP00000403208	0.514	Microtubule-associated protein 10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008017	1.000	microtubule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0016043	0.983	cellular component organization
GO:0010564	0.978	regulation of cell cycle process
GO:0032886	0.976	regulation of microtubule-based process
GO:0070925	0.972	organelle assembly
GO:0007059	0.969	chromosome segregation
GO:0007051	0.968	spindle organization
GO:1902850	0.968	microtubule cytoskeleton organization involved in mitosis
GO:0098813	0.948	nuclear chromosome segregation
GO:0007052	0.948	mitotic spindle organization
GO:0140694	0.947	non-membrane-bounded organelle assembly
GO:0051225	0.941	spindle assembly
GO:0000070	0.941	mitotic sister chromatid segregation
GO:0090307	0.929	mitotic spindle assembly
GO:0051493	0.897	regulation of cytoskeleton organization
GO:0032465	0.868	regulation of cytokinesis
GO:0070507	0.818	regulation of microtubule cytoskeleton organization
GO:0090224	0.791	regulation of spindle organization
GO:1902412	0.765	regulation of mitotic cytokinesis
GO:0060236	0.756	regulation of mitotic spindle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005874	1.000	microtubule
GO:0072686	0.997	mitotic spindle
GO:0005881	0.976	cytoplasmic microtubule
GO:0000235	0.973	astral microtubule
GO:0051233	0.970	spindle midzone
GO:0005829	0.917	cytosol
GO:0005813	0.689	centrosome
GO:0043227	0.617	membrane-bounded organelle
GO:0042995	0.389	cell projection
GO:0120025	0.379	plasma membrane bounded cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]