StarFunc result for job id Q49MI3

User Input

>input (558 residues)
MPWRRRRNRVSALEGGREEEAPPEAAAVPPALLTSPQQTEAAAERILLRGIFEIGRDSCD
VVLSERALRWRPIQPERPAGDSKYDLLCKEEFIELKDIFSVKLKRRCSVKQQRSGTLLGI
TLFICLKKEQNKLKNSTLDLINLSEDHCDIWFRQFKKILAGFPNRPKSLKILLNPQSHKK
EATQVYYEKVEPLLKLAGIKTDVTIMEYEGHALSLLKECELQGFDGGHRKPLFAIHWSVQ
RLFTGMQTLEPSVVCVGGDGSASEVAHALLLRAQKNAGMETDRILTPVRAQLPLGLIPAG
STNVLAHSLHGVPHVITATLHIIMGHVQLVDVCTFSTAGKLLRFGFSAMFGFGGRTLALA
EKYRWMSPNQRRDFAVVKALAKLKAEDCEISFLPFNSSDDVQERRAQGSPKSDCNDQWQM
IQGQFLNVSIMAIPCLCSVAPRGLAPNTRLNNGSMALIIARNTSRPEFIKHLKRYASVKN
QFNFPFVETYTVEEVKVHPRNNTGGYNPEEEEDETASENCFPWNVDGDLMEVASEVHIRL
HPRLISLYGGSMEEMIPK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q49MI3	1.000	1.000	0.000	558	1.000	1.000	Q49MI3.pdb.gz	CERKL_HUMAN Ceramide kinase-like protein OS=Homo sapiens OX=9606 GN=CERKL PE=1 SV=1
2	AFDB:A2AQH1	0.836	0.887	4.159E-89	525	0.690	0.733	A2AQH1.pdb.gz	A2AQH1_MOUSE Ceramide kinase-like OS=Mus musculus OX=10090 GN=Cerkl PE=2 SV=1
3	AFDB:G0XYF4	0.804	0.886	7.549E-82	505	0.661	0.731	G0XYF4.pdb.gz	G0XYF4_MOUSE Ceramide kinase-like isoform 6 OS=Mus musculus OX=10090 GN=Cerkl PE=2 SV=1
4	AFDB:A4QNW6	0.799	0.773	1.371E-78	577	0.534	0.516	A4QNW6.pdb.gz	A4QNW6_DANRE Ceramide kinase-like OS=Danio rerio OX=7955 GN=cerkl PE=2 SV=1
5	AFDB:G0XYF3	0.548	0.634	3.812E-74	481	0.625	0.726	G0XYF3.pdb.gz	G0XYF3_MOUSE Ceramide kinase-like isoform 5 OS=Mus musculus OX=10090 GN=Cerkl PE=2 SV=1
6	AFDB:G0XYF0	0.695	0.845	1.369E-68	456	0.577	0.706	G0XYF0.pdb.gz	G0XYF0_MOUSE Ceramide kinase-like isoform 2 OS=Mus musculus OX=10090 GN=Cerkl PE=2 SV=1
7	AFDB:G0XYF1	0.431	0.578	2.783E-59	412	0.523	0.709	G0XYF1.pdb.gz	G0XYF1_MOUSE Ceramide kinase-like isoform 3 OS=Mus musculus OX=10090 GN=Cerkl PE=2 SV=1
8	AFDB:Q8K4Q7	0.727	0.762	7.959E-52	531	0.251	0.264	Q8K4Q7.pdb.gz	CERK1_MOUSE Ceramide kinase OS=Mus musculus OX=10090 GN=Cerk PE=1 SV=2
9	AFDB:Q8TCT0	0.734	0.761	2.553E-50	537	0.260	0.270	Q8TCT0.pdb.gz	CERK1_HUMAN Ceramide kinase OS=Homo sapiens OX=9606 GN=CERK PE=1 SV=1
10	AFDB:Q9VNA6	0.731	0.600	2.625E-47	687	0.267	0.217	Q9VNA6.pdb.gz	Q9VNA6_DROME Ceramide kinase, isoform A OS=Drosophila melanogaster OX=7227 GN=Cerk PE=2 SV=2
11	PDB:4l02A	0.508	0.771	1.041E-24	360	0.154	0.239	4l02A.pdb.gz	Structure guided design of a series of sphingosine kinase (SphK) inhibitors.
12	PDB:2qv7A	0.419	0.732	2.241E-19	303	0.122	0.224	2qv7A.pdb.gz	Analysis of the Staphylococcus aureus DgkB Structure Reveals a Common Catalytic Mechanism for the Soluble Diacylglycerol Kinases.
13	PDB:7cgpB	0.441	0.683	7.396E-19	345	0.142	0.229	7cgpB.pdb.gz
14	PDB:2bonA	0.402	0.743	1.735E-16	287	0.118	0.230	2bonA.pdb.gz	Crystal Structure of Yegs, a Homologue to the Mammalian Diacylglycerol Kinases, Reveals a Novel Regulatory Metal Binding Site.
15	PDB:2bonB	0.377	0.741	2.240E-15	265	0.109	0.230	2bonB.pdb.gz	Crystal Structure of Yegs, a Homologue to the Mammalian Diacylglycerol Kinases, Reveals a Novel Regulatory Metal Binding Site.
16	PDB:7mezB	0.303	0.308	4.066E-8	547	0.099	0.101	7mezB.pdb.gz
17	PDB:7n29B	0.276	0.408	3.527E-7	350	0.079	0.126	7n29B.pdb.gz	Structure of human NADK2 reveals atypical assembly and regulation of NAD kinases from animal mitochondria.
18	PDB:1u0rD	0.294	0.481	2.437E-6	301	0.077	0.143	1u0rD.pdb.gz
19	PDB:1u0tB	0.281	0.490	1.009E-5	276	0.077	0.156	1u0tB.pdb.gz
20	PDB:1suwA	0.296	0.583	1.131E-5	249	0.073	0.165	1suwA.pdb.gz	Crystal Structures of an NAD Kinase from Archaeoglobus fulgidus in Complex with ATP, NAD, or NADP

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2AQH1	0.0	774	525	0.697	0.741	A2AQH1_MOUSE Ceramide kinase-like OS=Mus musculus OX=10090 GN=Cerkl PE=2 SV=1
2	A4QNW6	0.0	589	577	0.527	0.510	A4QNW6_DANRE Ceramide kinase-like OS=Danio rerio OX=7955 GN=cerkl PE=2 SV=1
3	G0XYF3	0.0	678	481	0.636	0.738	G0XYF3_MOUSE Ceramide kinase-like isoform 5 OS=Mus musculus OX=10090 GN=Cerkl PE=2 SV=1
4	G0XYF4	0.0	743	505	0.677	0.749	G0XYF4_MOUSE Ceramide kinase-like isoform 6 OS=Mus musculus OX=10090 GN=Cerkl PE=2 SV=1
5	Q49MI3	0.0	1159	558	1.000	1.000	CERKL_HUMAN Ceramide kinase-like protein OS=Homo sapiens OX=9606 GN=CERKL PE=1 SV=1
6	G0XYG0	4.08e-150	434	287	0.364	0.707	G0XYG0_MOUSE Ceramide kinase-like isoform 8 OS=Mus musculus OX=10090 GN=Cerkl PE=2 SV=1
7	G0XYF2	1.56e-143	419	331	0.346	0.583	G0XYF2_MOUSE Ceramide kinase-like isoform 4 OS=Mus musculus OX=10090 GN=Cerkl PE=2 SV=1
8	G0XYF1	2.72e-140	414	412	0.344	0.466	G0XYF1_MOUSE Ceramide kinase-like isoform 3 OS=Mus musculus OX=10090 GN=Cerkl PE=2 SV=1
9	G0XYF0	5.35e-139	412	456	0.341	0.417	G0XYF0_MOUSE Ceramide kinase-like isoform 2 OS=Mus musculus OX=10090 GN=Cerkl PE=2 SV=1
10	G0XYG8	8.92e-130	380	248	0.314	0.706	G0XYG8_MOUSE Ceramide kinase-like isoform 13 OS=Mus musculus OX=10090 GN=Cerkl PE=2 SV=1
11	G0XYF7	3.91e-123	364	260	0.357	0.765	G0XYF7_MOUSE Ceramide kinase-like isoform 9 OS=Mus musculus OX=10090 GN=Cerkl PE=2 SV=1
12	G0XYH3	1.83e-103	311	207	0.262	0.705	G0XYH3_MOUSE Ceramide kinase-like isoform 14 OS=Mus musculus OX=10090 GN=Cerkl PE=2 SV=1
13	G0XYF5	6.62e-102	308	212	0.289	0.759	G0XYF5_MOUSE Ceramide kinase-like isoform 7 OS=Mus musculus OX=10090 GN=Cerkl PE=2 SV=1
14	G0XYH9	5.69e-91	279	187	0.242	0.722	G0XYH9_MOUSE Ceramide kinase-like isoform 31 OS=Mus musculus OX=10090 GN=Cerkl PE=2 SV=1
15	G0XYF9	2.07e-86	268	216	0.296	0.764	G0XYF9_MOUSE Ceramide kinase-like isoform 10 OS=Mus musculus OX=10090 GN=Cerkl PE=2 SV=1
16	G0XYI0	2.52e-83	258	168	0.211	0.702	G0XYI0_MOUSE Ceramide kinase-like isoform 32 OS=Mus musculus OX=10090 GN=Cerkl PE=2 SV=1
17	G0XYH7	1.29e-62	204	137	0.167	0.679	G0XYH7_MOUSE Ceramide kinase-like isoform 29 OS=Mus musculus OX=10090 GN=Cerkl PE=2 SV=1
18	Q8K4Q7	1.44e-58	205	531	0.265	0.279	CERK1_MOUSE Ceramide kinase OS=Mus musculus OX=10090 GN=Cerk PE=1 SV=2
19	Q8TCT0	6.54e-58	204	537	0.244	0.253	CERK1_HUMAN Ceramide kinase OS=Homo sapiens OX=9606 GN=CERK PE=1 SV=1
20	A2AQH0	3.67e-46	159	107	0.131	0.682	A2AQH0_MOUSE Ceramide kinase-like (Fragment) OS=Mus musculus OX=10090 GN=Cerkl PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19280 CERK_C	2.2e-111	382.3	Ceramide kinase C-terminal domain
2	PF00781 DAGK_cat	4.5e-18	76.5	Diacylglycerol kinase catalytic domain
3	PF02982 Scytalone_dh	6.5e+02	11.5	Scytalone dehydratase
4	PF19279 YegS_C	3e+02	12.6	YegS C-terminal NAD kinase beta sandwich-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000341159

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359245	0.715	Retinal-specific ATP-binding cassette transporter
2	9606.ENSP00000424243	0.702	Protein eyes shut homolog
3	9606.ENSP00000385158	0.701	Protein FAM161A
4	9606.ENSP00000255266	0.691	Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha
5	9606.ENSP00000229771	0.688	Tubby-related protein 1
6	9606.ENSP00000362298	0.686	Sphingosine-1-phosphate lyase 1
7	9606.ENSP00000219368	0.685	Fatty acid 2-hydroxylase
8	9606.ENSP00000305941	0.683	Usherin
9	9606.ENSP00000356370	0.683	Protein crumbs homolog 1
10	9606.ENSP00000384264	0.683	cGMP-gated cation channel alpha-1
11	9606.ENSP00000449079	0.682	Retinol dehydrogenase 12
12	9606.ENSP00000251102	0.681	Cyclic nucleotide-gated cation channel beta-1
13	9606.ENSP00000324122	0.668	U4/U6 small nuclear ribonucleoprotein Prp31
14	9606.ENSP00000262554	0.667	Serine palmitoyltransferase 1
15	9606.ENSP00000420295	0.667	Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit beta
16	9606.ENSP00000315379	0.664	U4/U6 small nuclear ribonucleoprotein Prp3
17	9606.ENSP00000286688	0.656	Protein C8orf37
18	9606.ENSP00000378897	0.656	Neutral ceramidase
19	9606.ENSP00000434359	0.655	Poly(U)-binding-splicing factor PUF60
20	9606.ENSP00000465932	0.652	Progressive rod-cone degeneration protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046625	1.000	sphingolipid binding
GO:0003824	0.950	catalytic activity
GO:0016740	0.798	transferase activity
GO:0016772	0.559	transferase activity, transferring phosphorus-containing groups
GO:0016301	0.541	kinase activity
GO:0001727	0.474	lipid kinase activity
GO:0005515	0.434	protein binding
GO:0043167	0.303	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.923	cellular process
GO:0065007	0.876	biological regulation
GO:0050789	0.836	regulation of biological process
GO:0050794	0.818	regulation of cellular process
GO:0071704	0.756	organic substance metabolic process
GO:0044238	0.752	primary metabolic process
GO:0044237	0.727	cellular metabolic process
GO:0048523	0.709	negative regulation of cellular process
GO:0006807	0.612	nitrogen compound metabolic process
GO:0044255	0.605	cellular lipid metabolic process
GO:1901564	0.598	organonitrogen compound metabolic process
GO:0042981	0.586	regulation of apoptotic process
GO:0060548	0.585	negative regulation of cell death
GO:0006665	0.557	sphingolipid metabolic process
GO:0008610	0.475	lipid biosynthetic process
GO:0043069	0.469	negative regulation of programmed cell death
GO:0043066	0.433	negative regulation of apoptotic process
GO:0044249	0.385	cellular biosynthetic process
GO:1901566	0.368	organonitrogen compound biosynthetic process
GO:0046467	0.312	membrane lipid biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0005634	0.998	nucleus
GO:0012505	0.979	endomembrane system
GO:0070013	0.953	intracellular organelle lumen
GO:0005829	0.921	cytosol
GO:0005654	0.899	nucleoplasm
GO:0005783	0.864	endoplasmic reticulum
GO:0042995	0.676	cell projection
GO:0043232	0.663	intracellular non-membrane-bounded organelle
GO:0120025	0.659	plasma membrane bounded cell projection
GO:0001917	0.579	photoreceptor inner segment
GO:0001750	0.559	photoreceptor outer segment
GO:0016020	0.406	membrane
GO:0048471	0.307	perinuclear region of cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.798	Transferases.
EC:2.7.-.-	0.559	Transferring phosphorus-containing groups.

[back to server]