StarFunc result for job id Q4AC94

User Input

>input (2353 residues)
MKQRKGQGSGGSRGRKKRGLSDISPSTSLPPLVEGQLRCFLKLTVNRVIWKIAKPPTCVL
VRVRWWGETSDGTLFCPRDALQTEPKAVRTTTRYAIRCGPKQFTSYLTDMAVLVLEVITK
LDGLPIGRVQINGLAQLSPTHQINGFFTIVSSTSKKLGELQVSLALEPLSETYDSYHPLP
TTDMTENVLLSKQGFRENTEPSSTQFQVPSRPRDIHTIKIDGKELAANSSRSTTPRGKDH
VCFAENPDTIKDSSFGLQHSLNSGQSLESVTLKGRAPRKQMSLLNSSEFQPQIRTVAKSH
SDSCILSSNNLPTKDLLSALLEQGNKLRNAMVISAMKSSPETSMLLDQVHPPINEDSLRA
STQIRAFSRNRFKDHIEDHLLPSTENTFWRHDTKADTRAIQLLLGSAELSQGNFWDGLGS
PPDSPSPGSDVYCISELNDPQYDQSLLENLFYTAPKSDTSISDFLSEEDDIVPSKKISQS
TALARSSKVLESSDHKLKKRSAGKRNRNLVEQQMLSETPEDAQTMTLSVDRLALLGRTHS
VRIIIETMGVPPDSPQMTPGKKSYAGPPPKVTTAKKRTFFVEYHFPVGFSESGLGKTALI
TEVVRLASSKITDGKVKFQQRFVFPVQFGGPMIEHWWNSNLTFQIYVKKTPQKKPEVIGS
VSLSLRAVIQSELLSFSDQLPVQQENGQSPFGPLKVTMELITDNKDFTGINTKLSGNTHY
TPLCAPTSPNKALPELNQDMTCTKNPQNLNQIHEETAKKAQNLVLPNRKSPSPVAPHPST
FVATPASHNLVNQTNGTTKESALLLHVLLMVPDGKDFISGESEKQSPCNVYLNCKLFSTE
EVTRSVIAWGTTQPVFNFSQVIPVSLSSKYLERLKNNVMVIETWNKVRSPGQDKLLGLVK
LPLHQFYMSFKDAKISRLLLDAQYPVVAVDSYMPVIDVFSGHQNGSLRVFLAMGSSNQIM
ALQRLKNEEGTLPPFSPRPAHFLDQPTAASVAMAEDRGNGLMEHCFEIHIEMVKGLAPLQ
ATVWGEADCYVQYYFPVQHSQSSVLKGPEFLENGITLKPFRTATTLCVPDPIFNSEHHHS
LLLPAEVPVQRLLLSAFSAQGLVPGGGVQFEIWCRYYYPNVRDQKVAKGTLPLSRICAMV
TTQHREDVGIQTFNLPLTPRIENRKELRNQSSGLLDVGLRYRRSPRTAEGVLAARTVSIS
VQIIRACGLQAAAKALAEREPALQFSATVGVNASVTTHLSFLPQGEQRRTHPVACSFCPE
FSHHVEFTCNLVTQHCSGEACFLAELLEFAEVIFAVYHENTKSASDIISIESCKEYLLGV
VKVPTKELLIKRSGITGWYPIILPEDGGLPHGLELMQKIVGGLELSISFTHRGDRERVLE
AAEHLGWSFENSLKDFVRMDEGEPATVTISTPRLWLPIHCVLLAGHNHIHKNTYCYLRYK
FYDHEAFWTPLKKPKESVNKKQIMVTFKASKRAEVTRGPSLLWYFREERLEIQVWRAYGN
DSVERPHQTDSWIGSAYVDLARLGERSARTLTVSGVYPLFGRNASNLSGAALRVHVVLSS
LSSHLEPTHELDSMDCSSHSESEQLPRRNDEVQLSPPEVISCHQKSPASTQVPCSSTTAE
VRLTQEGPADLDGTFAVSILVERAMHLSLKGSPLTERKVSIPSCCVSFATADESSPVYTQ
VVENTDSPIWNFQQQSRLSKELLLDPQQTLVFKVWHKGDEERVIGFASVDLSPLLSGFQF
VCGWYNITDFSGECQGQIKVAVSPLESLIHFKEERQARRGVETSKSLIPIYSPFSFPASD
TYAAFSSHMARQTLDQLAHASSKELDFSSPGRSDTTRSQASRHEEHVQNIRRFHESLHLQ
GEAPLPCDDKLTTSPLSSQTSILTSLRKNLSELDQIQRYFRQKLTKPFLPLSPQTQTAIS
QHQESCRDHLGPGASSLDPGSQCILEKSSNLVLQVSSLITDLQTITRDSQAALSSHRARS
RSNKATTLPDAQDTEALQERCTMPDEPLVRAPDKGTDSPSPPPLEETSNGGRMLHESLRH
AVPITRMQSSEDTEAGPAYSDEDYEEDIIEPRTLNEITTVTDKTSPWSSVISDTSEVISP
QPDEVQREGPSCPSPGPFCREELMVKSSFLSSPERAVNPHLPRQGSPSQSLVACECEASK
ARVGGESASANPQPIPCPTLSGAQQSSTFVGWSSPQTDQNKEPKSEAPAENEAATSELGD
SADSFKKLPLNLASQSRRENHKGPPIDSSDIRQRQVTTGSETSTKQSLLLPGPIVVPNFF
LPPQQLEASLRMLSLSATLPPAATTDQDKSEATRGALSQRPCRPRPNSLPLNLPEEETLR
IARIFSSQYSQKD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q4AC94	1.000	1.000	0.000	2353	1.000	1.000	Q4AC94.pdb.gz	C2CD3_HUMAN C2 domain-containing protein 3 OS=Homo sapiens OX=9606 GN=C2CD3 PE=1 SV=4
2	AFDB:Q57WH0	0.063	0.097	8.554E-17	1241	0.076	0.143	Q57WH0.pdb.gz	Q57WH0_TRYB2 C2 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.28B13.500 PE=4 SV=1
3	PDB:5iz5B	0.049	0.143	2.908E-9	746	0.017	0.052	5iz5B.pdb.gz
4	PDB:6kxkD	0.078	0.234	6.672E-8	553	0.020	0.087	6kxkD.pdb.gz	Crystal Structure of an Arabidopsis Copine providing insights into this protein family
5	PDB:5iz5A	0.046	0.134	1.533E-7	757	0.015	0.048	5iz5A.pdb.gz
6	AFDB:Q6WKZ4	0.054	0.095	2.598E-7	1283	0.045	0.083	Q6WKZ4.pdb.gz	RFIP1_HUMAN Rab11 family-interacting protein 1 OS=Homo sapiens OX=9606 GN=RAB11FIP1 PE=1 SV=3
7	PDB:5ixcA	0.050	0.157	3.043E-7	684	0.019	0.066	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
8	AFDB:B7Z0K1	0.040	0.071	2.860E-6	1137	0.065	0.134	B7Z0K1.pdb.gz	B7Z0K1_DROME Bitesize, isoform H OS=Drosophila melanogaster OX=7227 GN=btsz PE=4 SV=1
9	PDB:5izrC	0.050	0.161	3.350E-6	659	0.017	0.062	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
10	AFDB:M9PDD2	0.057	0.179	5.960E-6	655	0.043	0.154	M9PDD2.pdb.gz	M9PDD2_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=anon-WO0118547.182 PE=3 SV=1
11	AFDB:Q8N3D4	0.055	0.082	1.305E-5	1523	0.053	0.081	Q8N3D4.pdb.gz	EH1L1_HUMAN EH domain-binding protein 1-like protein 1 OS=Homo sapiens OX=9606 GN=EHBP1L1 PE=1 SV=2
12	PDB:1cjyA	0.045	0.152	2.261E-5	633	0.009	0.035	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
13	PDB:4rj9A	0.047	0.549	3.185E-5	161	0.011	0.168	4rj9A.pdb.gz
14	PDB:5a50A	0.046	0.524	3.345E-5	165	0.010	0.145	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
15	PDB:5a52A	0.051	0.608	4.068E-5	154	0.008	0.117	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
16	AFDB:Q4KWH8	0.049	0.067	1.240E-4	1693	0.065	0.090	Q4KWH8.pdb.gz	PLCH1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 OS=Homo sapiens OX=9606 GN=PLCH1 PE=1 SV=1
17	AFDB:Q2Q0I9	0.032	0.039	1.584E-4	1779	0.080	0.106	Q2Q0I9.pdb.gz	FNDC1_RAT Fibronectin type III domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Fndc1 PE=1 SV=2
18	PDB:3nsjA	0.044	0.185	1.602E-4	530	0.009	0.042	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.
19	AFDB:P32927	0.038	0.079	1.927E-4	897	0.053	0.138	P32927.pdb.gz	IL3RB_HUMAN Cytokine receptor common subunit beta OS=Homo sapiens OX=9606 GN=CSF2RB PE=1 SV=2
20	AFDB:Q4ZHG4	0.032	0.036	2.231E-4	1894	0.071	0.089	Q4ZHG4.pdb.gz	FNDC1_HUMAN Fibronectin type III domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FNDC1 PE=2 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q4AC94	0.0	4853	2353	1.000	1.000	C2CD3_HUMAN C2 domain-containing protein 3 OS=Homo sapiens OX=9606 GN=C2CD3 PE=1 SV=4
2	Q52KB6	0.0	3537	2323	0.753	0.762	C2CD3_MOUSE C2 domain-containing protein 3 OS=Mus musculus OX=10090 GN=C2cd3 PE=1 SV=3
3	Q9FMM3	2.8	35.8	1714	0.012	0.017	EXA1_ARATH Protein ESSENTIAL FOR POTEXVIRUS ACCUMULATION 1 OS=Arabidopsis thaliana OX=3702 GN=EXA1 PE=1 SV=1
4	Q9S7J9	5.2	33.5	185	0.011	0.146	CAR9_ARATH Protein C2-DOMAIN ABA-RELATED 9 OS=Arabidopsis thaliana OX=3702 GN=CAR9 PE=2 SV=1
5	P23287	8.9	33.9	553	0.007	0.029	PP2B1_YEAST Serine/threonine-protein phosphatase 2B catalytic subunit A1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CNA1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	2.2e-14	64.9	C2 domain
2	PF15627 CEP76-C2	2e+02	13.1	CEP76 C2 domain
3	PF10358 NT-C2	21	16.3	N-terminal C2 in EEIG1 and EHBP1 proteins

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000334379

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000344314	0.891	Oral-facial-digital syndrome 1 protein
2	9606.ENSP00000380911	0.873	Centrosomal protein of 83 kDa
3	9606.ENSP00000346359	0.823	Protein TALPID3
4	9606.ENSP00000306105	0.787	Centrosomal protein of 89 kDa
5	9606.ENSP00000323580	0.758	Intraflagellar transport protein 88 homolog
6	9606.ENSP00000281142	0.757	Sodium channel and clathrin linker 1
7	9606.ENSP00000324292	0.746	Fas-binding factor 1
8	9606.ENSP00000385215	0.729	Centrosomal protein of 162 kDa
9	9606.ENSP00000303058	0.728	Centrosomal protein of 120 kDa
10	9606.ENSP00000381461	0.724	Protein phosphatase methylesterase 1
11	9606.ENSP00000278935	0.703	Centrosomal protein of 164 kDa
12	9606.ENSP00000389014	0.689	Protein JBTS17
13	9606.ENSP00000267890	0.659	Tau-tubulin kinase 2
14	9606.ENSP00000326342	0.652	ELMO domain-containing protein 2
15	9606.ENSP00000344431	0.640	DnaJ homolog subfamily B member 13
16	9606.ENSP00000362121	0.626	Intraflagellar transport protein 52 homolog
17	9606.ENSP00000381270	0.623	Protein broad-minded
18	9606.ENSP00000370803	0.615	Centriolar coiled-coil protein of 110 kDa
19	9606.ENSP00000342510	0.614	Centrosomal protein of 97 kDa
20	9606.ENSP00000260570	0.611	Intraflagellar transport protein 172 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0016043	0.960	cellular component organization
GO:0030031	0.918	cell projection assembly
GO:0060271	0.908	cilium assembly
GO:0051179	0.847	localization
GO:0008104	0.705	protein localization
GO:0007017	0.678	microtubule-based process
GO:0000226	0.632	microtubule cytoskeleton organization
GO:0022402	0.613	cell cycle process
GO:0033365	0.613	protein localization to organelle
GO:0140694	0.587	non-membrane-bounded organelle assembly
GO:0051298	0.578	centrosome duplication
GO:1905508	0.574	protein localization to microtubule organizing center
GO:0007099	0.565	centriole replication
GO:0050789	0.489	regulation of biological process
GO:0050794	0.468	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005814	1.000	centriole
GO:0034451	1.000	centriolar satellite
GO:0005829	0.995	cytosol
GO:0043227	0.986	membrane-bounded organelle
GO:0005929	0.956	cilium
GO:0036064	0.692	ciliary basal body
GO:0043231	0.374	intracellular membrane-bounded organelle
GO:0070013	0.368	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]