StarFunc result for job id Q4ADV7

User Input

>input (1423 residues)
MYFLSGWPKRLLCPLGSPAEAPFHVQSDPQRAFFAVLAAARLSIWYSRPSVLIVTYKEPA
KSSTQFGSYKQAEWRPDSTMIAVSTANGYILFFHITSTRGDKYLYEPVYPKGSPQMKGTP
HFKEEQCAPALNLEMRKILDLQAPIMSLQSVLEDLLVATSDGLLHLIHWEGMTNGRKAIN
LCTVPFSVDLQSSRVGSFLGFTDVHIRDMEYCATLDGFAVVFNDGKVGFITPVSSRFTAE
QLHGVWPQDVVDGTCVAVNNKYRLMAFGCVSGSVQVYTIDNSTGAMLLSHKLELTAKQYP
DIWNKTGAVKLMRWSPDNSVVIVTWEYGGLSLWSVFGAQLICTLGGDFAYRSDGTKKDPL
KINSMSWGAEGYHLWVISGFGSQNTEIESDLRSVVKQPSILLFQFIKSVLTVNPCMSNQE
QVLLQGEDRLYLNCGEASQTQNPRSSSTHSEHKPSREKSPFADGGLESQGLSTLLGHRHW
HVVQISSTYLESNWPIRFSAIDKLGQNIAVVGKFGFAHYSLLTKKWKLFGNITQEQNMIV
TGGLAWWNDFMVLACYNINDRQEELRVYLRTSNLDNAFAHVTKAQAETLLLSVFQDMVIV
FRADCSICLYSIERKSDGPNTTAGIQVLQEVSMSRYIPHPFLVVSVTLTSVSTENGITLK
MPQQARGAESIMLNLAGQLIMMQRDRSGPQIREKDSNPNNQRKLLPFCPPVVLAQSVENV
WTTCRANKQKRHLLEALWLSCGGAGMKVWLPLFPRDHRKPHSFLSQRIMLPFHINIYPLA
VLFEDALVLGAVNDTLLYDSLYTRNNAREQLEVLFPFCVVERTSQIYLHHILRQLLVRNL
GEQALLLAQSCATLPYFPHVLELMLHEVLEEEATSREPIPDPLLPTVAKFITEFPLFLQT
VVHCARKTEYALWNYLFAAVGNPKDLFEECLMAQDLDTAASYLIILQNMEVPAVSRQHAT
LLFNTALEQGKWDLCRHMIRFLKAIGSGESETPPSTPTAQEPSSSGGFEFFRNRSISLSQ
SAENVPASKFSLQKTLSMPSGPSGKRWSKDSDCAENMYIDMMLWRHARRLLEDVRLKDLG
CFAAQLGFELISWLCKERTRAARVDNFVIALKRLHKDFLWPLPIIPASSISSPFKNGKYR
TVGEQLLKSQSADPFLNLEMDAGISNIQRSQSWLSNIGPTHHEIDTASSHGPQMQDAFLS
PLSNKGDECSIGSATDLTESSSMVDGDWTMVDENFSTLSLTQSELEHISMELASKGPHKS
QVQLRYLLHIFMEAGCLDWCIVIGLILRESSIINQILVITQSSEVDGEMLQNIKTGLHAV
DRWASTDCPGYKPFLNIIKPQLQKLSEITEEQVQPDAFQPITMGKTPEQTSPRAEESRGS
SSHGSIPQGEVGSSNMVSRKEEDTAQAEEEEPFQDGTYDCSVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q4ADV7	0.999	0.999	0.000	1423	1.000	1.000	Q4ADV7.pdb.gz	RIC1_HUMAN Guanine nucleotide exchange factor subunit RIC1 OS=Homo sapiens OX=9606 GN=RIC1 PE=1 SV=2
2	AFDB:Q9V3C5	0.730	0.727	4.349E-104	1429	0.334	0.332	Q9V3C5.pdb.gz	RIC1_DROME Guanine nucleotide exchange factor subunit Rich OS=Drosophila melanogaster OX=7227 GN=Rich PE=1 SV=1
3	AFDB:O42656	0.515	0.683	1.338E-52	1052	0.150	0.202	O42656.pdb.gz	RIC1_SCHPO Guanine nucleotide exchange factor subunit ric1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ric1 PE=1 SV=2
4	PDB:7mqaLO	0.136	0.217	1.360E-16	819	0.077	0.134	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
5	PDB:7ajtUA	0.129	0.199	8.418E-16	834	0.085	0.145	7ajtUA.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
6	PDB:7mq8LO	0.135	0.210	2.447E-15	848	0.079	0.133	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
7	PDB:7mqaLQ	0.137	0.215	3.990E-15	830	0.085	0.146	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
8	PDB:6lqsB1	0.135	0.211	1.160E-14	806	0.083	0.146	6lqsB1.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
9	PDB:5nzrC	0.178	0.287	2.470E-14	843	0.072	0.121	5nzrC.pdb.gz
10	PDB:7mq8LT	0.165	0.261	5.749E-14	869	0.086	0.140	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
11	PDB:6qk7A	0.191	0.224	8.968E-14	1161	0.075	0.092	6qk7A.pdb.gz	Molecular basis of tRNA recognition by the Elongator complex.
12	PDB:7mq8LR	0.174	0.305	5.310E-13	773	0.067	0.124	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:7ajuUL	0.164	0.285	8.659E-13	779	0.071	0.130	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
14	AFDB:M9PB01	0.171	0.105	3.325E-12	2397	0.103	0.061	M9PB01.pdb.gz	M9PB01_DROME WD repeat domain 62, isoform G OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=4 SV=1
15	AFDB:Q57VP9	0.144	0.083	9.181E-8	2653	0.110	0.059	Q57VP9.pdb.gz	Q57VP9_TRYB2 EF-hand domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29O4.100 PE=4 SV=1
16	AFDB:Q86BR7	0.175	0.308	2.234E-7	777	0.044	0.081	Q86BR7.pdb.gz	Q86BR7_DROME GATOR complex protein WDR24 OS=Drosophila melanogaster OX=7227 GN=Wdr24 PE=3 SV=2
17	AFDB:P38968	0.115	0.127	3.218E-6	1273	0.096	0.107	P38968.pdb.gz	SEC31_YEAST Protein transport protein SEC31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC31 PE=1 SV=3
18	AFDB:Q960J6	0.097	0.114	8.949E-6	1183	0.096	0.115	Q960J6.pdb.gz	Q960J6_DROME LD47622p OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=2 SV=1
19	AFDB:Q13409	0.184	0.387	1.396E-5	638	0.031	0.069	Q13409.pdb.gz	DC1I2_HUMAN Cytoplasmic dynein 1 intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1I2 PE=1 SV=3
20	AFDB:Q24371	0.094	0.150	6.617E-5	769	0.088	0.163	Q24371.pdb.gz	L2DTL_DROME Protein lethal(2)denticleless OS=Drosophila melanogaster OX=7227 GN=l(2)dtl PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q4ADV7	0.0	2962	1423	1.000	1.000	RIC1_HUMAN Guanine nucleotide exchange factor subunit RIC1 OS=Homo sapiens OX=9606 GN=RIC1 PE=1 SV=2
2	Q9V3C5	0.0	746	1429	0.339	0.337	RIC1_DROME Guanine nucleotide exchange factor subunit Rich OS=Drosophila melanogaster OX=7227 GN=Rich PE=1 SV=1
3	F4K735	6.99e-64	240	1127	0.202	0.256	F4K735_ARATH Quinoprotein amine dehydrogenase, beta chain-like RIC1-like guanyl-nucleotide exchange factor OS=Arabidopsis thaliana OX=3702 GN=At5g28350 PE=1 SV=1
4	F4JEA6	1.13e-55	214	1081	0.181	0.238	F4JEA6_ARATH Quinoprotein amine dehydrogenase, beta chain-like RIC1-like guanyl-nucleotide exchange factor OS=Arabidopsis thaliana OX=3702 GN=At3g61480 PE=1 SV=2
5	O42656	1.11e-12	75.5	1052	0.100	0.135	RIC1_SCHPO Guanine nucleotide exchange factor subunit ric1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ric1 PE=1 SV=2
6	Q382D3	2.81e-05	51.2	1248	0.078	0.089	Q382D3_TRYB2 Ribosome control protein 1 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5610 PE=4 SV=1
7	Q9VC96	2.1	35.4	2232	0.022	0.014	Q9VC96_DROME BRWD3 OS=Drosophila melanogaster OX=7227 GN=BRWD3 PE=1 SV=2
8	Q8SX63	2.6	35.0	1765	0.022	0.018	Q8SX63_DROME LD40380p OS=Drosophila melanogaster OX=7227 GN=BRWD3 PE=2 SV=1
9	Q04947	4.5	33.9	295	0.018	0.088	RTN1_YEAST Reticulon-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RTN1 PE=1 SV=1
10	P0CJ48	7.9	32.7	267	0.010	0.052	CB1A_ARATH Chlorophyll a-b binding protein 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LHCB1.1 PE=1 SV=1
11	Q8VZ87	7.9	32.7	267	0.010	0.052	CB1B_ARATH Chlorophyll a-b binding protein 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LHCB1.2 PE=1 SV=2
12	P40395	8.4	33.5	1056	0.011	0.014	RIC1_YEAST Guanine nucleotide exchange factor subunit RIC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIC1 PE=1 SV=1
13	O60237	9.6	33.1	982	0.032	0.047	MYPT2_HUMAN Protein phosphatase 1 regulatory subunit 12B OS=Homo sapiens OX=9606 GN=PPP1R12B PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	0.028	26.0	Anaphase-promoting complex subunit 4 WD40 domain
2	PF07064 RIC1	1.7e-76	268.6	RIC1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000416696

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000367318	0.990	RAB6A-GEF complex partner protein 2
2	9606.ENSP00000311449	0.944	Ras-related protein Rab-6A
3	9606.ENSP00000305459	0.931	Conserved oligomeric Golgi complex subunit 8
4	9606.ENSP00000394071	0.923	Rab GDP dissociation inhibitor alpha
5	9606.ENSP00000319781	0.910	Ras-related protein Rab-43
6	9606.ENSP00000369538	0.910	Rab GDP dissociation inhibitor beta
7	9606.ENSP00000350386	0.903	Rab proteins geranylgeranyltransferase component A 1
8	9606.ENSP00000355511	0.902	Rab proteins geranylgeranyltransferase component A 2
9	9606.ENSP00000243918	0.896	Protein SYS1 homolog
10	9606.ENSP00000306496	0.896	Ras-related protein Rab-33B
11	9606.ENSP00000285208	0.876	Ras-related protein Rab-6B
12	9606.ENSP00000258654	0.863	Conserved oligomeric Golgi complex subunit 3
13	9606.ENSP00000355629	0.833	Conserved oligomeric Golgi complex subunit 2
14	9606.ENSP00000305442	0.829	Conserved oligomeric Golgi complex subunit 7
15	9606.ENSP00000397441	0.825	Conserved oligomeric Golgi complex subunit 6
16	9606.ENSP00000297135	0.824	Conserved oligomeric Golgi complex subunit 5
17	9606.ENSP00000299886	0.818	Conserved oligomeric Golgi complex subunit 1
18	9606.ENSP00000315775	0.810	Conserved oligomeric Golgi complex subunit 4
19	9606.ENSP00000263116	0.763	Ras-related protein Rab-36
20	9606.ENSP00000401435	0.760	Vacuolar protein sorting-associated protein 53 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031267	1.000	small GTPase binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0046907	0.993	intracellular transport
GO:0016192	0.991	vesicle-mediated transport
GO:0065007	0.981	biological regulation
GO:0016482	0.977	cytosolic transport
GO:0016197	0.957	endosomal transport
GO:0050794	0.946	regulation of cellular process
GO:0048856	0.793	anatomical structure development
GO:0043087	0.764	regulation of GTPase activity
GO:0043547	0.732	positive regulation of GTPase activity
GO:0051128	0.727	regulation of cellular component organization
GO:0019222	0.611	regulation of metabolic process
GO:0009894	0.600	regulation of catabolic process
GO:0042147	0.583	retrograde transport, endosome to Golgi
GO:0032879	0.576	regulation of localization
GO:0048519	0.508	negative regulation of biological process
GO:0051049	0.482	regulation of transport
GO:0051246	0.449	regulation of protein metabolic process
GO:0071840	0.418	cellular component organization or biogenesis
GO:0016043	0.386	cellular component organization
GO:0051248	0.375	negative regulation of protein metabolic process
GO:0009895	0.354	negative regulation of catabolic process
GO:0051046	0.340	regulation of secretion
GO:0042176	0.338	regulation of protein catabolic process
GO:1904888	0.334	cranial skeletal system development
GO:1903053	0.329	regulation of extracellular matrix organization
GO:1903530	0.328	regulation of secretion by cell

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	1.000	Golgi apparatus
GO:0032991	0.999	protein-containing complex
GO:0016020	0.999	membrane
GO:0005829	0.999	cytosol
GO:0032588	0.990	trans-Golgi network membrane
GO:0032045	0.975	guanyl-nucleotide exchange factor complex
GO:0034066	0.697	Ric1-Rgp1 guanyl-nucleotide exchange factor complex
GO:0031982	0.654	vesicle
GO:0031410	0.605	cytoplasmic vesicle
GO:0098588	0.420	bounding membrane of organelle
GO:0000139	0.368	Golgi membrane
GO:0071944	0.302	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]