StarFunc result for job id Q4FZB7

User Input

>input (885 residues)
MKWLGESKNMVVNGRRNGGKLSNDHQQNQSKLQHTGKDTLKAGKNAVERRSNRCNGNSGF
EGQSRYVPSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTSAFPSRSSRHFSKSDSFS
HNNPVRFRPIKGRQEELKEVIERFKKDEHLEKAFKCLTSGEWARHYFLNKNKMQEKLFKE
HVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEEN
MLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPG
EEISCYYGDGFFGENNEFCECYTCERRGTGAFKSRVGLPAPAPVINSKYGLRETDKRLNR
LKKLGDSSKNSDSQSVSSNTDADTTQEKNNATSNRKSSVGVKKNSKSRTLTRQSMSRIPA
SSNSTSSKLTHINNSRVPKKLKKPAKPLLSKIKLRNHCKRLEQKNASRKLEMGNLVLKEP
KVVLYKNLPIKKDKEPEGPAQAAVASGCLTRHAAREHRQNPVRGAHSQGESSPCTYITRR
SVRTRTNLKEASDIKLEPNTLNGYKSSVTEPCPDSGEQLQPAPVLQEEELAHETAQKGEA
KCHKSDTGMSKKKSRQGKLVKQFAKIEESTPVHDSPGKDDAVPDLMGPHSDQGEHSGTVG
VPVSYTDCAPSPVGCSVVTSDSFKTKDSFRTAKSKKKRRITRYDAQLILENNSGIPKLTL
RRRHDSSSKTNDQENDGMNSSKISIKLSKDHDNDNNLYVAKLNNGFNSGSGSSSTKLKIQ
LKRDEENRGSYTEGLHENGVCCSDPLSLLESRMEVDDYSQYEEESTDDSSSSEGDEEEDD
YDDDFEDDFIPLPPAKRLRLIVGKDSIDIDISSRRREDQSLRLNA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3U8K7	0.533	0.534	0.000	883	0.871	0.873	Q3U8K7.pdb.gz	KMT5B_MOUSE Histone-lysine N-methyltransferase KMT5B OS=Mus musculus OX=10090 GN=Kmt5b PE=1 SV=2
2	AFDB:Q4FZB7	1.000	1.000	0.000	885	1.000	1.000	Q4FZB7.pdb.gz	KMT5B_HUMAN Histone-lysine N-methyltransferase KMT5B OS=Homo sapiens OX=9606 GN=KMT5B PE=1 SV=5
3	PDB:5h6zA	0.113	0.699	2.636E-6	123	0.034	0.244	5h6zA.pdb.gz
4	PDB:2g46A	0.109	0.682	1.677E-5	119	0.032	0.235	2g46A.pdb.gz	Structural insights of the specificity and catalysis of a viral histone H3 lysine 27 methyltransferase.
5	AFDB:Q10362	0.126	0.130	2.760E-5	859	0.125	0.129	Q10362.pdb.gz	SET3_SCHPO SET domain-containing protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=set3 PE=1 SV=1
6	PDB:5hynA	0.106	0.159	3.106E-5	581	0.026	0.040	5hynA.pdb.gz	Structural basis of oncogenic histone H3K27M inhibition of human polycomb repressive complex 2.
7	PDB:7td5F	0.102	0.193	7.202E-5	447	0.024	0.047	7td5F.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
8	PDB:5wg6A	0.107	0.176	8.056E-5	517	0.040	0.068	5wg6A.pdb.gz	An Evolutionarily Conserved Structural Platform for PRC2 Inhibition by a Class of Ezh2 Inhibitors.
9	PDB:7td5A	0.102	0.175	9.012E-5	497	0.024	0.042	7td5A.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
10	PDB:7ksoA	0.104	0.221	1.193E-4	395	0.025	0.056	7ksoA.pdb.gz	Structures of monomeric and dimeric PRC2:EZH1 reveal flexible modules involved in chromatin compaction.
11	PDB:6wkrC	0.098	0.140	5.123E-4	606	0.027	0.040	6wkrC.pdb.gz	JARID2 and AEBP2 regulate PRC2 in the presence of H2AK119ub1 and other histone modifications.
12	PDB:1pegA	0.102	0.311	1.062E-3	266	0.025	0.083	1pegA.pdb.gz	Structural basis for the product specificity of histone lysine methyltransferases
13	PDB:3qxyA	0.080	0.157	1.860E-3	420	0.020	0.043	3qxyA.pdb.gz	Structural basis of SETD6-mediated regulation of the NF-kB network via methyl-lysine signaling.
14	AFDB:E9Q5F9	0.130	0.051	1.646E-2	2537	0.147	0.051	E9Q5F9.pdb.gz	SETD2_MOUSE Histone-lysine N-methyltransferase SETD2 OS=Mus musculus OX=10090 GN=Setd2 PE=1 SV=1
15	AFDB:A2A7B5	0.120	0.068	1.948E-2	1709	0.134	0.070	A2A7B5.pdb.gz	A2A7B5_MOUSE PR domain containing 2, with ZNF domain OS=Mus musculus OX=10090 GN=Prdm2 PE=1 SV=1
16	AFDB:G8BHR3	0.058	0.057	3.609E-2	913	0.086	0.083	G8BHR3.pdb.gz	G8BHR3_CANPC GH18 domain-containing protein OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=CHT21 PE=4 SV=1
17	AFDB:Q9UBL0	0.054	0.057	1.107E-1	812	0.132	0.144	Q9UBL0.pdb.gz	ARP21_HUMAN cAMP-regulated phosphoprotein 21 OS=Homo sapiens OX=9606 GN=ARPP21 PE=1 SV=2
18	AFDB:Q15032	0.063	0.055	1.310E-1	1099	0.116	0.094	Q15032.pdb.gz	R3HD1_HUMAN R3H domain-containing protein 1 OS=Homo sapiens OX=9606 GN=R3HDM1 PE=1 SV=3
19	AFDB:Q6ZS17	0.060	0.048	2.295E-1	1223	0.129	0.093	Q6ZS17.pdb.gz	RIPR1_HUMAN Rho family-interacting cell polarization regulator 1 OS=Homo sapiens OX=9606 GN=RIPOR1 PE=1 SV=1
20	AFDB:Q96L73	0.124	0.047	2.427E-1	2696	0.118	0.039	Q96L73.pdb.gz	NSD1_HUMAN Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Homo sapiens OX=9606 GN=NSD1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3U8K7	0.0	1500	883	0.871	0.873	KMT5B_MOUSE Histone-lysine N-methyltransferase KMT5B OS=Mus musculus OX=10090 GN=Kmt5b PE=1 SV=2
2	Q4FZB7	0.0	1835	885	1.000	1.000	KMT5B_HUMAN Histone-lysine N-methyltransferase KMT5B OS=Homo sapiens OX=9606 GN=KMT5B PE=1 SV=5
3	Q5U3H2	0.0	744	808	0.546	0.598	KMT5B_DANRE Histone-lysine N-methyltransferase KMT5B OS=Danio rerio OX=7955 GN=kmt5b PE=2 SV=2
4	Q6Q783	7.64e-111	350	468	0.190	0.359	KMT5C_MOUSE Histone-lysine N-methyltransferase KMT5C OS=Mus musculus OX=10090 GN=Kmt5c PE=1 SV=1
5	Q86Y97	1.64e-110	349	462	0.190	0.364	KMT5C_HUMAN Histone-lysine N-methyltransferase KMT5C OS=Homo sapiens OX=9606 GN=KMT5C PE=1 SV=1
6	Q9W5E0	1.62e-99	340	1300	0.195	0.133	SUV42_DROME Histone-lysine N-methyltransferase Suv4-20 OS=Drosophila melanogaster OX=7227 GN=Hmt4-20 PE=1 SV=1
7	A5D6U3	1.29e-96	314	522	0.179	0.303	A5D6U3_DANRE [histone H4]-N-methyl-L-lysine20 N-methyltransferase KMT5B OS=Danio rerio OX=7955 GN=suv420h2 PE=2 SV=1
8	A0A0D9SF94	1.87e-66	228	347	0.119	0.303	A0A0D9SF94_HUMAN [histone H4]-N-methyl-L-lysine20 N-methyltransferase KMT5B OS=Homo sapiens OX=9606 GN=KMT5C PE=1 SV=1
9	Q09265	4.11e-62	214	288	0.140	0.431	SUV42_CAEEL Histone-lysine N-methyltransferase Suv4-20 OS=Caenorhabditis elegans OX=6239 GN=set-4 PE=1 SV=1
10	Q9USK2	2.64e-24	109	441	0.068	0.136	SET9_SCHPO Histone-lysine N-methyltransferase set9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=set9 PE=1 SV=1
11	Q9VW15	6.92e-04	46.2	2226	0.032	0.013	ASH1_DROME Histone-lysine N-methyltransferase ash1 OS=Drosophila melanogaster OX=7227 GN=ash1 PE=1 SV=3
12	Q38AF8	0.003	43.5	457	0.021	0.042	Q38AF8_TRYB2 SET domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.2470 PE=4 SV=1
13	Q389M6	0.005	43.1	999	0.024	0.021	Q389M6_TRYB2 SET domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.26.0910 PE=4 SV=1
14	P38827	0.020	41.2	1080	0.036	0.030	SET1_YEAST Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SET1 PE=1 SV=1
15	F4K1J4	0.021	41.2	1423	0.042	0.026	ATXR7_ARATH Histone-lysine N-methyltransferase ATXR7 OS=Arabidopsis thaliana OX=3702 GN=ATXR7 PE=2 SV=1
16	O74467	0.021	40.4	319	0.024	0.066	SET5_SCHPO SET domain-containing protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=set5 PE=1 SV=1
17	Q9VYD1	0.032	40.8	2313	0.037	0.014	C1716_DROME Probable histone-lysine N-methyltransferase CG1716 OS=Drosophila melanogaster OX=7227 GN=Set2 PE=1 SV=2
18	Q99MY8	0.036	40.4	2958	0.032	0.009	ASH1L_MOUSE Histone-lysine N-methyltransferase ASH1L OS=Mus musculus OX=10090 GN=Ash1l PE=1 SV=3
19	Q9H7B4	0.038	40.0	428	0.024	0.049	SMYD3_HUMAN Histone-lysine N-methyltransferase SMYD3 OS=Homo sapiens OX=9606 GN=SMYD3 PE=1 SV=4
20	Q55FF7	0.051	39.7	898	0.027	0.027	Q55FF7_DICDI SET domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0268132 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00856 SET	2.1e-08	46.2	SET domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000305899

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000399968	0.911	Nuclear receptor coactivator 2
2	9606.ENSP00000384629	0.907	N-lysine methyltransferase KMT5A
3	9606.ENSP00000346997	0.826	Histone-lysine N-methyltransferase SUV39H2
4	9606.ENSP00000386759	0.826	Histone-lysine N-methyltransferase SETD2
5	9606.ENSP00000337976	0.819	Histone-lysine N-methyltransferase SUV39H1
6	9606.ENSP00000367755	0.802	Calmodulin-lysine N-methyltransferase
7	9606.ENSP00000271640	0.798	Histone-lysine N-methyltransferase SETDB1
8	9606.ENSP00000419184	0.796	Histone-lysine N-methyltransferase SMYD3
9	9606.ENSP00000244537	0.780	Histone cluster 1 H4 family member f
10	9606.ENSP00000381657	0.740	Histone-lysine N-methyltransferase, H3 lysine-79 specific
11	9606.ENSP00000262519	0.739	Histone-lysine N-methyltransferase SETD1A
12	9606.ENSP00000376204	0.733	Histone-lysine N-methyltransferase ASH1L
13	9606.ENSP00000313983	0.714	Histone-lysine N-methyltransferase NSD3
14	9606.ENSP00000479106	0.712	Histone cluster 1 H4 family member a
15	9606.ENSP00000347168	0.711	Histone cluster 1 H4 family member j
16	9606.ENSP00000366956	0.711	Histone cluster 1 H4 family member h
17	9606.ENSP00000366974	0.711	Histone cluster 1 H4 family member b
18	9606.ENSP00000367034	0.711	Histone cluster 1 H4 family member c
19	9606.ENSP00000443017	0.711	Histone cluster 4, H4
20	9606.ENSP00000462355	0.711	Histone cluster 2 H4 family member b

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003682	1.000	chromatin binding
GO:0042799	1.000	histone H4K20 methyltransferase activity
GO:0018024	1.000	histone lysine N-methyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0044238	0.993	primary metabolic process
GO:0050794	0.991	regulation of cellular process
GO:0060255	0.991	regulation of macromolecule metabolic process
GO:0006807	0.990	nitrogen compound metabolic process
GO:0044237	0.988	cellular metabolic process
GO:0043170	0.988	macromolecule metabolic process
GO:0048583	0.979	regulation of response to stimulus
GO:0009893	0.978	positive regulation of metabolic process
GO:0031323	0.974	regulation of cellular metabolic process
GO:0080090	0.973	regulation of primary metabolic process
GO:0051171	0.973	regulation of nitrogen compound metabolic process
GO:0044260	0.961	cellular macromolecule metabolic process
GO:0010604	0.956	positive regulation of macromolecule metabolic process
GO:0019219	0.955	regulation of nucleobase-containing compound metabolic process
GO:0051052	0.945	regulation of DNA metabolic process
GO:0051054	0.939	positive regulation of DNA metabolic process
GO:0050896	0.908	response to stimulus
GO:0080135	0.881	regulation of cellular response to stress
GO:1901360	0.867	organic cyclic compound metabolic process
GO:0051716	0.862	cellular response to stimulus
GO:2001020	0.859	regulation of response to DNA damage stimulus
GO:0048584	0.837	positive regulation of response to stimulus
GO:0006950	0.821	response to stress
GO:0006974	0.777	cellular response to DNA damage stimulus
GO:0090304	0.768	nucleic acid metabolic process
GO:0010468	0.630	regulation of gene expression
GO:0006259	0.583	DNA metabolic process
GO:0006282	0.483	regulation of DNA repair
GO:1901564	0.366	organonitrogen compound metabolic process
GO:0043412	0.365	macromolecule modification
GO:2000779	0.356	regulation of double-strand break repair
GO:0036211	0.355	protein modification process
GO:0006281	0.332	DNA repair
GO:2001022	0.327	positive regulation of response to DNA damage stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0043232	0.977	intracellular non-membrane-bounded organelle
GO:0005694	0.892	chromosome
GO:0098687	0.477	chromosomal region
GO:0005737	0.454	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:51736	1.000	L-lysyl-[protein] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl-[protein] + S-adenosyl-L-homocysteine

[back to server]