StarFunc result for job id Q4G0G2

User Input

>input (97 residues)
MGWEQETQKSRPWNQVEGRQPGHDPEQDTCSTSPFAMSKSSLRPPKKLMPCASCTAAEPD
GFPWLCYSHSWKCCLTESSGHPGRMDVVYPLLYRWGN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q09829	0.134	0.022	5.697	780	0.237	0.029	Q09829.pdb.gz	YAD3_SCHPO Pumilio domain-containing protein C4G8.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4G8.03c PE=4 SV=1
2	AFDB:Q580M4	0.142	0.068	6.663	408	0.186	0.044	Q580M4.pdb.gz	Q580M4_TRYB2 T. brucei spp.-specific protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.26J7.310 PE=4 SV=1
3	AFDB:Q8TEY5	0.143	0.051	8.427	395	0.175	0.043	Q8TEY5.pdb.gz	CR3L4_HUMAN Cyclic AMP-responsive element-binding protein 3-like protein 4 OS=Homo sapiens OX=9606 GN=CREB3L4 PE=1 SV=1
4	AFDB:Q3TIV5	0.138	0.040	9.113	426	0.124	0.028	Q3TIV5.pdb.gz	ZC3HF_MOUSE Zinc finger CCCH domain-containing protein 15 OS=Mus musculus OX=10090 GN=Zc3h15 PE=1 SV=2
5	AFDB:Q9FL40	0.163	0.060	9.113	363	0.206	0.055	Q9FL40.pdb.gz	C3H53_ARATH Zinc finger CCCH domain-containing protein 53 OS=Arabidopsis thaliana OX=3702 GN=At5g07060 PE=2 SV=1
6	AFDB:Q17381	0.104	0.030	9.856	506	0.165	0.032	Q17381.pdb.gz	PHA4_CAEEL Defective pharyngeal development protein 4 OS=Caenorhabditis elegans OX=6239 GN=pha-4 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G5ECB2	0.57	30.8	842	0.103	0.012	GABR2_CAEEL Gamma-aminobutyric acid type B receptor subunit 2 OS=Caenorhabditis elegans OX=6239 GN=gbb-2 PE=1 SV=1
2	P0AEJ4	1.9	29.3	450	0.165	0.036	ENVZ_ECOLI Sensor histidine kinase EnvZ OS=Escherichia coli (strain K12) OX=83333 GN=envZ PE=1 SV=1
3	Q54G11	2.5	28.5	126	0.134	0.103	ATG8L_DICDI Autophagy-related protein 8-like protein DDB_G0290491 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0290491 PE=3 SV=1
4	Q555V8	2.7	28.9	1112	0.175	0.015	Q555V8_DICDI Acetylglutamate kinase OS=Dictyostelium discoideum OX=44689 GN=argB PE=4 SV=2
5	Q96ER9	3.3	28.5	411	0.186	0.044	MITOK_HUMAN Mitochondrial potassium channel OS=Homo sapiens OX=9606 GN=CCDC51 PE=1 SV=2
6	Q9D2Z8	3.4	28.5	642	0.227	0.034	KIF12_MOUSE Kinesin-like protein KIF12 OS=Mus musculus OX=10090 GN=Kif12 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 556268.OFAG_02182

Rank	PPI partner	STRING score	Description
1	556268.OFAG_01060	0.629	annotation not available

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.996	protein binding
GO:1990837	0.431	sequence-specific double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.627	biological regulation
GO:0050789	0.600	regulation of biological process
GO:0019222	0.388	regulation of metabolic process
GO:0031323	0.345	regulation of cellular metabolic process
GO:0010468	0.345	regulation of gene expression
GO:0051171	0.315	regulation of nitrogen compound metabolic process
GO:0031326	0.310	regulation of cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0005622	0.993	intracellular anatomical structure
GO:0005737	0.877	cytoplasm
GO:0016020	0.813	membrane
GO:0043226	0.395	organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]