StarFunc result for job id Q4G0J3

User Input

>input (582 residues)
METESGNQEKVMEEESTEKKKEVEKKKRSRVKQVLADIAKQVDFWFGDANLHKDRFLREQ
IEKSRDGYVDISLLVSFNKMKKLTTDGKLIARALRSSAVVELDLEGTRIRRKKPLGERPK
DEDERTVYVELLPKNVNHSWIERVFGKCGNVVYISIPHYKSTGDPKGFAFVEFETKEQAA
KAIEFLNNPPEEAPRKPGIFPKTVKNKPIPALRVVEEKKKKKKKKGRMKKEDNIQAKEEN
MDTSNTSISKMKRSRPTSEGSDIESTEPQKQCSKKKKKRDRVEASSLPEVRTGKRKRSSS
EDAESLAPRSKVKKIIQKDIIKEASEASKENRDIEISTEEEKDTGDLKDSSLLKTKRKHK
KKHKERHKMGEEVIPLRVLSKSEWMDLKKEYLALQKASMASLKKTISQIKSESEMETDSG
VPQNTGMKNEKTANREECRTQEKVNATGPQFVSGVIVKIISTEPLPGRKQVRDTLAAISE
VLYVDLLEGDTECHARFKTPEDAQAVINAYTEINKKHCWKLEILSGDHEQRYWQKILVDR
QAKLNQPREKKRGTEKLITKAEKIRLAKTQQASKHIRFSEYD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q4G0J3	1.000	1.000	1.193E-95	582	1.000	1.000	Q4G0J3.pdb.gz	LARP7_HUMAN La-related protein 7 OS=Homo sapiens OX=9606 GN=LARP7 PE=1 SV=1
2	AFDB:Q05CL8	0.769	0.784	2.360E-78	570	0.799	0.816	Q05CL8.pdb.gz	LARP7_MOUSE La-related protein 7 OS=Mus musculus OX=10090 GN=Larp7 PE=1 SV=2
3	AFDB:Q7ZWE3	0.611	0.637	4.117E-57	555	0.519	0.544	Q7ZWE3.pdb.gz	LARP7_DANRE La-related protein 7 OS=Danio rerio OX=7955 GN=larp7 PE=2 SV=1
4	AFDB:O80567	0.206	0.218	1.141E-12	545	0.108	0.116	O80567.pdb.gz	LRP6B_ARATH La-related protein 6B OS=Arabidopsis thaliana OX=3702 GN=LARP6B PE=1 SV=2
5	AFDB:Q3THB3	0.115	0.097	2.606E-11	690	0.172	0.145	Q3THB3.pdb.gz	Q3THB3_MOUSE RRM domain-containing protein OS=Mus musculus OX=10090 GN=Hnrnpm PE=1 SV=1
6	AFDB:Q20084	0.127	0.158	2.273E-10	456	0.108	0.138	Q20084.pdb.gz	Q20084_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=exc-7 PE=1 SV=1
7	AFDB:A0A024R753	0.125	0.097	6.321E-10	759	0.146	0.112	A0A024R753.pdb.gz	A0A024R753_HUMAN RNA binding motif protein 28 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=RBM28 PE=2 SV=1
8	AFDB:B8BCZ8	0.119	0.094	2.844E-9	738	0.134	0.106	B8BCZ8.pdb.gz	FCA_ORYSI Flowering time control protein FCA OS=Oryza sativa subsp. indica OX=39946 GN=FCA PE=3 SV=2
9	AFDB:A0A2R8QGL1	0.111	0.073	4.888E-9	927	0.093	0.058	A0A2R8QGL1.pdb.gz
10	AFDB:F1QGN3	0.131	0.209	7.448E-9	345	0.081	0.136	F1QGN3.pdb.gz
11	PDB:7lmaH	0.139	0.390	3.945E-7	199	0.057	0.166	7lmaH.pdb.gz	Structures of telomerase at several steps of telomere repeat synthesis.
12	PDB:6y53o	0.110	0.393	3.050E-6	160	0.040	0.144	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
13	PDB:6qx91K	0.116	0.329	3.654E-6	201	0.043	0.124	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
14	PDB:5yzg1	0.108	0.257	1.969E-5	243	0.043	0.103	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
15	PDB:5oobB	0.112	0.410	3.594E-5	152	0.046	0.178	5oobB.pdb.gz	Structural basis for mutually exclusive co-transcriptional nuclear cap-binding complexes with either NELF-E or ARS2.
16	PDB:6gd1A	0.106	0.314	5.476E-5	190	0.031	0.095	6gd1A.pdb.gz
17	PDB:5lsbA	0.108	0.351	6.966E-5	176	0.033	0.108	5lsbA.pdb.gz
18	PDB:3lqvB	0.106	0.508	9.410E-5	115	0.031	0.157	3lqvB.pdb.gz	Branch Recognition by SF3b14
19	PDB:7dvqY	0.115	0.455	9.410E-5	140	0.033	0.136	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
20	PDB:6n7pY	0.114	0.459	9.994E-5	138	0.031	0.130	6n7pY.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D6RFF0	0.0	607	299	0.514	1.000	D6RFF0_HUMAN La-related protein 7 (Fragment) OS=Homo sapiens OX=9606 GN=LARP7 PE=1 SV=1
2	Q05CL8	0.0	830	570	0.780	0.796	LARP7_MOUSE La-related protein 7 OS=Mus musculus OX=10090 GN=Larp7 PE=1 SV=2
3	Q4G0J3	0.0	1181	582	1.000	1.000	LARP7_HUMAN La-related protein 7 OS=Homo sapiens OX=9606 GN=LARP7 PE=1 SV=1
4	Q7ZWE3	0.0	542	555	0.531	0.557	LARP7_DANRE La-related protein 7 OS=Danio rerio OX=7955 GN=larp7 PE=2 SV=1
5	D6RF49	9.38e-77	240	119	0.204	1.000	D6RF49_HUMAN La ribonucleoprotein 7, transcriptional regulator (Fragment) OS=Homo sapiens OX=9606 GN=LARP7 PE=1 SV=1
6	P40796	3.37e-18	89.0	390	0.101	0.151	LA_DROME La protein homolog OS=Drosophila melanogaster OX=7227 GN=La PE=1 SV=2
7	Q54TG6	6.40e-17	84.7	354	0.086	0.141	Q54TG6_DICDI Lupus La protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0281763 PE=1 SV=1
8	Q9NIH4	3.69e-15	79.3	335	0.082	0.143	Q9NIH4_9TRYP RNA binding protein La-like protein OS=Trypanosoma brucei OX=5691 PE=1 SV=1
9	Q38C07	4.15e-15	79.0	335	0.082	0.143	Q38C07_TRYB2 La protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.5360 PE=4 SV=1
10	Q9N9G6	4.15e-15	79.0	335	0.082	0.143	Q9N9G6_9TRYP La protein OS=Trypanosoma brucei OX=5691 GN=La PE=2 SV=1
11	P05455	6.09e-15	79.3	408	0.095	0.135	LA_HUMAN Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2
12	W7X6T2	1.58e-13	75.5	542	0.079	0.085	LARP7_TETTS La-related protein 7 homolog OS=Tetrahymena thermophila (strain SB210) OX=312017 GN=TAP65 PE=1 SV=1
13	P33399	3.66e-13	72.4	275	0.091	0.193	LHP1_YEAST La protein homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LHP1 PE=1 SV=2
14	P32067	4.84e-13	73.6	415	0.088	0.123	LA_MOUSE Lupus La protein homolog OS=Mus musculus OX=10090 GN=Ssb PE=1 SV=1
15	Q9BRS8	6.69e-13	73.6	491	0.100	0.118	LARP6_HUMAN La-related protein 6 OS=Homo sapiens OX=9606 GN=LARP6 PE=1 SV=1
16	P38656	1.20e-12	72.4	415	0.089	0.125	LA_RAT Lupus La protein homolog OS=Rattus norvegicus OX=10116 GN=Ssb PE=1 SV=1
17	Q8BN59	2.81e-12	71.6	492	0.098	0.116	LARP6_MOUSE La-related protein 6 OS=Mus musculus OX=10090 GN=Larp6 PE=1 SV=1
18	A1Z9R1	1.40e-11	70.1	867	0.110	0.074	A1Z9R1_DROME Achilles, isoform A OS=Drosophila melanogaster OX=7227 GN=Achl PE=2 SV=1
19	Q93ZV7	1.76e-11	68.9	433	0.084	0.113	LA1_ARATH La protein 1 OS=Arabidopsis thaliana OX=3702 GN=LA1 PE=1 SV=1
20	O80567	2.00e-11	68.9	545	0.084	0.090	LRP6B_ARATH La-related protein 6B OS=Arabidopsis thaliana OX=3702 GN=LARP6B PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16572 HlyD_D4	4.1e+02	12.3	Long alpha hairpin domain of cation efflux system protein, CusB
2	PF05383 La	1.4e-18	77.9	La domain
3	PF00076 RRM_1	6.7e-15	66.0	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
4	PF08777 RRM_3	1.1e-26	104.1	RNA binding motif
5	PF19977 xRRM	0.012	27.2	xRRM domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000422626

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000308546	0.998	7SK snRNA methylphosphate capping enzyme
2	9606.ENSP00000328773	0.996	Protein HEXIM1
3	9606.ENSP00000362361	0.989	Cyclin-dependent kinase 9
4	9606.ENSP00000261900	0.978	Cyclin-T1
5	9606.ENSP00000302276	0.963	Protein HEXIM2
6	9606.ENSP00000228284	0.946	Squamous cell carcinoma antigen recognized by T-cells 3
7	9606.ENSP00000386488	0.911	Zinc finger CCCH domain-containing protein 8
8	9606.ENSP00000361626	0.847	Nuclease-sensitive element-binding protein 1
9	9606.ENSP00000342778	0.836	Protein phosphatase, Mg2+/Mn2+ dependent 1G
10	9606.ENSP00000363745	0.836	Heterogeneous nuclear ribonucleoprotein R
11	9606.ENSP00000308000	0.819	Speckle targeted PIP5K1A-regulated poly(A) polymerase
12	9606.ENSP00000346120	0.817	Nucleolar RNA helicase 2
13	9606.ENSP00000341826	0.797	Heterogeneous nuclear ribonucleoprotein A1
14	9606.ENSP00000318195	0.764	Nucleolin
15	9606.ENSP00000386636	0.761	Lupus La protein
16	9606.ENSP00000225792	0.758	Probable ATP-dependent RNA helicase DDX5
17	9606.ENSP00000370589	0.751	Nucleolar protein 56
18	9606.ENSP00000221801	0.743	rRNA 2'-O-methyltransferase fibrillarin
19	9606.ENSP00000360034	0.740	Plasminogen activator inhibitor 1 RNA-binding protein
20	9606.ENSP00000263377	0.726	Bromodomain-containing protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0017070	1.000	U6 snRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0050789	0.995	regulation of biological process
GO:0034641	0.995	cellular nitrogen compound metabolic process
GO:0043170	0.994	macromolecule metabolic process
GO:0050794	0.984	regulation of cellular process
GO:0006396	0.975	RNA processing
GO:0019222	0.969	regulation of metabolic process
GO:0016073	0.948	snRNA metabolic process
GO:0016074	0.946	sno(s)RNA metabolic process
GO:0060255	0.944	regulation of macromolecule metabolic process
GO:0031123	0.943	RNA 3'-end processing
GO:0009893	0.928	positive regulation of metabolic process
GO:0019219	0.918	regulation of nucleobase-containing compound metabolic process
GO:0043144	0.911	sno(s)RNA processing
GO:0032259	0.906	methylation
GO:0044260	0.906	cellular macromolecule metabolic process
GO:0043628	0.901	regulatory ncRNA 3'-end processing
GO:0051173	0.899	positive regulation of nitrogen compound metabolic process
GO:0048522	0.896	positive regulation of cellular process
GO:0010556	0.896	regulation of macromolecule biosynthetic process
GO:0031326	0.896	regulation of cellular biosynthetic process
GO:0009892	0.895	negative regulation of metabolic process
GO:0048523	0.890	negative regulation of cellular process
GO:0031325	0.886	positive regulation of cellular metabolic process
GO:1903311	0.884	regulation of mRNA metabolic process
GO:0010605	0.878	negative regulation of macromolecule metabolic process
GO:0010468	0.864	regulation of gene expression
GO:0043412	0.857	macromolecule modification
GO:0031324	0.848	negative regulation of cellular metabolic process
GO:0048024	0.843	regulation of mRNA splicing, via spliceosome
GO:0006355	0.809	regulation of DNA-templated transcription
GO:0051253	0.802	negative regulation of RNA metabolic process
GO:0010558	0.785	negative regulation of macromolecule biosynthetic process
GO:0031327	0.775	negative regulation of cellular biosynthetic process
GO:0045935	0.768	positive regulation of nucleobase-containing compound metabolic process
GO:0009451	0.761	RNA modification
GO:0043414	0.686	macromolecule methylation
GO:0001510	0.682	RNA methylation
GO:0006357	0.636	regulation of transcription by RNA polymerase II
GO:0010604	0.624	positive regulation of macromolecule metabolic process
GO:0031328	0.542	positive regulation of cellular biosynthetic process
GO:1903507	0.446	negative regulation of nucleic acid-templated transcription
GO:0045892	0.436	negative regulation of DNA-templated transcription
GO:0010557	0.417	positive regulation of macromolecule biosynthetic process
GO:0032784	0.359	regulation of DNA-templated transcription elongation
GO:0051254	0.320	positive regulation of RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.999	protein-containing complex
GO:0005737	0.998	cytoplasm
GO:0005829	0.985	cytosol
GO:0043232	0.947	intracellular non-membrane-bounded organelle
GO:1990904	0.908	ribonucleoprotein complex
GO:0140513	0.838	nuclear protein-containing complex
GO:0120114	0.580	Sm-like protein family complex
GO:0030532	0.483	small nuclear ribonucleoprotein complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]