StarFunc result for job id Q4G0N8

User Input

>input (1177 residues)
MAGIFKEFFFSTEDLPEVILTLSLISSIGAFLNRHLEDFPIPVPVILFLLGCSFEVLSFT
SSQVQRYANAIQWMSPDLFFRIFTPVVFFTTAFDMDTYMLQKLFWQILLISIPGFLVNYI
LVLWHLASVNQLLLKPTQWLLFSAILVSSDPMLTAAAIRDLGLSRSLISLINGESLMTSV
ISLITFTSIMDFDQRLQSKRNHTLAEEIVGGICSYIIASFLFGILSSKLIQFWMSTVFGD
DVNHISLIFSILYLIFYICELVGMSGIFTLAIVGLLLNSTSFKAAIEETLLLEFWTFLSR
IAFLMVFTFFGLLIPAHTYLYIEFVDIYYSLNIYLTLIVLRFLTLLLISPVLSRVGHEFS
WRWIFIMVCSEMKGMPNINMALLLAYSDLYFGSDKEKSQILFHGVLVCLITLVVNRFILP
VAVTILGLRDATSTKYKSVCCTFQHFQELTKSAASALKFDKDLANADWNMIEKAITLENP
YMLNEEETTEHQKVKCPHCNKEIDEIFNTEAMELANRRLLSAQIASYQRQYRNEILSQSA
VQVLVGAAESFGEKKGKCMSLDTIKNYSESQKTVTFARKLLLNWVYNTRKEKEGPSKYFF
FRICHTIVFTEEFEHVGYLVILMNIFPFIISWISQLNVIYHSELKHTNYCFLTLYILEAL
LKIAAMRKDFFSHAWNIFELAITLIGILHVILIEIDTIKYIFNETEVIVFIKVVQFFRIL
RIFKLIAPKLLQIIDKRMSHQKTFWYGILKGYVQGEADIMTIIDQITSSKQIKQMLLKQV
IRNMEHAIKELGYLEYDHPEIAVTVKTKEEINVMLNMATEILKAFGLKGIISKTEGAGIN
KLIMAKKKEVLDSQSIIRPLTVEEVLYHIPWLDKNKDYINFIQEKAKVVTFDCGNDIFEE
GDEPKGIYIIISGMVKLEKSKPGLGIDQMVESKEKDFPIIDTDYMLSGEIIGEINCLTNE
PMKYSATCKTVVETCFIPKTHLYDAFEQCSPLIKQKMWLKLGLAITARKIREHLSYEDWN
YNMQLKLSNIYVVDIPMSTKTDIYDENLIYVILIHGAVEDCLLRKTYRAPFLIPITCHQI
QSIEDFTKVVIIQTPINMKTFRRNIRKFVPKHKSYLTPGLIGSVGTLEEGIQEERNVKED
GAHSAATARSPQPCSLLGTKFNCKESPRINLRKVRKE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6UJY2	0.898	0.899	0.000	1175	0.666	0.667	Q6UJY2.pdb.gz	SL9C1_MOUSE Sodium/hydrogen exchanger 10 OS=Mus musculus OX=10090 GN=Slc9c1 PE=1 SV=3
2	AFDB:Q9LKW9	0.562	0.575	6.078E-37	1146	0.150	0.154	Q9LKW9.pdb.gz	NHX7_ARATH Sodium/hydrogen exchanger 7 OS=Arabidopsis thaliana OX=3702 GN=NHX7 PE=1 SV=1
3	AFDB:Q3YL57	0.501	0.758	4.882E-25	756	0.125	0.194	Q3YL57.pdb.gz	NHX8_ARATH Sodium/hydrogen exchanger 8 OS=Arabidopsis thaliana OX=3702 GN=NHX8 PE=2 SV=1
4	AFDB:Q8S396	0.317	0.677	1.046E-13	521	0.063	0.142	Q8S396.pdb.gz	NHX5_ARATH Sodium/hydrogen exchanger 5 OS=Arabidopsis thaliana OX=3702 GN=NHX5 PE=2 SV=2
5	AFDB:P32703	0.312	0.641	1.340E-13	549	0.082	0.175	P32703.pdb.gz	YJCE_ECOLI Uncharacterized Na(+)/H(+) exchanger YjcE OS=Escherichia coli (strain K12) OX=83333 GN=yjcE PE=3 SV=1
6	AFDB:A0A0H2UP25	0.336	0.556	2.389E-13	684	0.101	0.174	A0A0H2UP25.pdb.gz	A0A0H2UP25_STRPN Transporter, monovalent cation:proton antiporter-2 (CPA2) family OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_0655 PE=1 SV=1
7	AFDB:Q28362	0.323	0.446	2.818E-13	839	0.088	0.124	Q28362.pdb.gz	SL9A3_DIDVI Sodium/hydrogen exchanger 3 OS=Didelphis virginiana OX=9267 GN=SLC9A3 PE=1 SV=1
8	AFDB:Q8RWU6	0.318	0.659	4.258E-13	535	0.071	0.157	Q8RWU6.pdb.gz	NHX6_ARATH Sodium/hydrogen exchanger 6 OS=Arabidopsis thaliana OX=3702 GN=NHX6 PE=1 SV=3
9	AFDB:M9PGE2	0.328	0.307	6.706E-13	1257	0.082	0.077	M9PGE2.pdb.gz	M9PGE2_DROME Sodium/hydrogen exchanger OS=Drosophila melanogaster OX=7227 GN=Nhe2 PE=3 SV=1
10	AFDB:G5EBK1	0.328	0.483	7.910E-13	783	0.069	0.103	G5EBK1.pdb.gz	PBO4_CAEEL Na(+)/H(+) exchanger protein 7 OS=Caenorhabditis elegans OX=6239 GN=pbo-4 PE=1 SV=1
11	PDB:4czbB	0.287	0.739	3.520E-9	419	0.062	0.174	4czbB.pdb.gz
12	PDB:5dykA	0.103	0.142	4.551E-8	809	0.031	0.046	5dykA.pdb.gz
13	PDB:6byrB	0.082	0.310	2.577E-7	288	0.031	0.125	6byrB.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
14	PDB:4bwzA	0.259	0.687	5.884E-7	384	0.059	0.180	4bwzA.pdb.gz	A two-domain elevator mechanism for sodium/proton antiport.
15	PDB:7wswA	0.117	0.239	5.884E-7	472	0.050	0.125	7wswA.pdb.gz
16	PDB:3i54D	0.099	0.445	1.006E-6	228	0.030	0.154	3i54D.pdb.gz	Structural Insights into the Mechanism of the Allosteric Transitions of Mycobacterium tuberculosis cAMP Receptor Protein.
17	PDB:7rhsA	0.097	0.234	2.601E-6	456	0.053	0.136	7rhsA.pdb.gz
18	PDB:7xufA	0.138	0.263	2.944E-6	476	0.052	0.128	7xufA.pdb.gz
19	PDB:4byyA	0.102	0.478	3.332E-6	226	0.031	0.164	4byyA.pdb.gz
20	PDB:3j4qB	0.091	0.259	3.771E-6	382	0.024	0.073	3j4qB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6UJY2	0.0	1588	1175	0.667	0.668	SL9C1_MOUSE Sodium/hydrogen exchanger 10 OS=Mus musculus OX=10090 GN=Slc9c1 PE=1 SV=3
2	Q3YL57	5.32e-30	130	756	0.118	0.184	NHX8_ARATH Sodium/hydrogen exchanger 8 OS=Arabidopsis thaliana OX=3702 GN=NHX8 PE=2 SV=1
3	Q9LKW9	8.86e-27	121	1146	0.105	0.107	NHX7_ARATH Sodium/hydrogen exchanger 7 OS=Arabidopsis thaliana OX=3702 GN=NHX7 PE=1 SV=1
4	A0A060Y126	1.19e-07	58.5	798	0.048	0.071	A0A060Y126_ONCMY Sodium/hydrogen exchanger OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00042155001 PE=3 SV=1
5	Q9P0X4	1.22e-07	58.9	2223	0.031	0.016	CAC1I_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1I OS=Homo sapiens OX=9606 GN=CACNA1I PE=1 SV=1
6	A4GWV2	1.55e-07	58.2	752	0.048	0.076	A4GWV2_ONCMY Sodium/hydrogen exchanger OS=Oncorhynchus mykiss OX=8022 GN=NHE3 PE=2 SV=2
7	E9Q7P2	4.65e-07	57.0	2199	0.026	0.014	E9Q7P2_MOUSE Voltage-dependent T-type calcium channel subunit alpha OS=Mus musculus OX=10090 GN=Cacna1i PE=1 SV=1
8	Q9Z0Y8	4.73e-07	57.0	2201	0.026	0.014	CAC1I_RAT Voltage-dependent T-type calcium channel subunit alpha-1I OS=Rattus norvegicus OX=10116 GN=Cacna1i PE=1 SV=3
9	E0CXK2	1.03e-06	55.8	1835	0.024	0.015	E0CXK2_MOUSE Voltage-dependent T-type calcium channel subunit alpha OS=Mus musculus OX=10090 GN=Cacna1i PE=1 SV=1
10	Q8MQP4	1.67e-06	55.1	999	0.065	0.077	Q8MQP4_DROME Sodium/hydrogen exchanger (Fragment) OS=Drosophila melanogaster OX=7227 GN=Nhe2 PE=2 SV=1
11	P27732	2.69e-06	54.7	2203	0.040	0.021	CAC1D_RAT Voltage-dependent L-type calcium channel subunit alpha-1D OS=Rattus norvegicus OX=10116 GN=Cacna1d PE=1 SV=2
12	M9NFD1	2.78e-06	54.3	1166	0.067	0.068	M9NFD1_DROME Sodium/hydrogen exchanger OS=Drosophila melanogaster OX=7227 GN=Nhe2 PE=3 SV=1
13	M9PDJ7	3.85e-06	53.9	1177	0.067	0.067	M9PDJ7_DROME Sodium/hydrogen exchanger OS=Drosophila melanogaster OX=7227 GN=Nhe2 PE=3 SV=1
14	B7YZY2	4.01e-06	53.9	1322	0.068	0.061	B7YZY2_DROME Sodium/hydrogen exchanger OS=Drosophila melanogaster OX=7227 GN=Nhe2 PE=3 SV=1
15	M9PGE2	4.24e-06	53.9	1257	0.068	0.064	M9PGE2_DROME Sodium/hydrogen exchanger OS=Drosophila melanogaster OX=7227 GN=Nhe2 PE=3 SV=1
16	B7YZY1	4.60e-06	53.5	1229	0.068	0.065	B7YZY1_DROME Sodium/hydrogen exchanger OS=Drosophila melanogaster OX=7227 GN=Nhe2 PE=3 SV=1
17	M9NDU7	5.17e-06	53.5	1222	0.068	0.065	M9NDU7_DROME Sodium/hydrogen exchanger OS=Drosophila melanogaster OX=7227 GN=Nhe2 PE=3 SV=1
18	Q9VIF9	5.18e-06	53.5	1291	0.068	0.062	Q9VIF9_DROME Sodium/hydrogen exchanger OS=Drosophila melanogaster OX=7227 GN=Nhe2 PE=3 SV=2
19	B7YZY3	5.39e-06	53.5	1219	0.068	0.066	B7YZY3_DROME Sodium/hydrogen exchanger OS=Drosophila melanogaster OX=7227 GN=Nhe2 PE=3 SV=1
20	Q3UQG9	5.58e-06	53.1	853	0.030	0.041	Q3UQG9_MOUSE Ion transport domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Cacna1g PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00027 cNMP_binding	2.8e-08	45.0	Cyclic nucleotide-binding domain
2	PF12724 Flavodoxin_5	2.3e+02	13.5	Flavodoxin domain
3	PF00520 Ion_trans	2.1e-06	38.7	Ion transport protein
4	PF00999 Na_H_Exchanger	1.8e-24	97.9	Sodium/hydrogen exchanger family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000306627

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356825	0.853	Adenylate cyclase type 10
2	9606.ENSP00000263980	0.837	Sodium/hydrogen exchanger 1
3	9606.ENSP00000215909	0.735	Galectin-1
4	9606.ENSP00000349629	0.697	Lipopolysaccharide-responsive and beige-like anchor protein
5	9606.ENSP00000216027	0.634	Iron-sulfur cluster co-chaperone protein HscB, mitochondrial
6	9606.ENSP00000356953	0.609	Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
7	9606.ENSP00000260649	0.588	Neutral and basic amino acid transport protein rBAT
8	9606.ENSP00000273359	0.588	Mycophenolic acid acyl-glucuronide esterase, mitochondrial
9	9606.ENSP00000378265	0.586	Sodium/hydrogen exchanger 9B2
10	9606.ENSP00000296422	0.578	Sodium/hydrogen exchanger 9B1
11	9606.ENSP00000359729	0.572	Sodium/hydrogen exchanger 6
12	9606.ENSP00000382770	0.567	Potassium channel subfamily U member 1
13	9606.ENSP00000296695	0.566	Serine protease inhibitor Kazal-type 1
14	9606.ENSP00000297524	0.559	Solute carrier family 7 member 13
15	9606.ENSP00000265080	0.558	Ras-specific guanine nucleotide-releasing factor 2
16	9606.ENSP00000309052	0.527	Cation channel sperm-associated protein 1
17	9606.ENSP00000442397	0.507	Sodium-dependent phosphate transport protein 2C
18	9606.ENSP00000370083	0.505	Survival of motor neuron 1, telomeric
19	9606.ENSP00000299798	0.501	Sodium/hydrogen exchanger 5
20	9606.ENSP00000370737	0.501	Glycine dehydrogenase (decarboxylating), mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0015385	1.000	sodium:proton antiporter activity
GO:0005216	0.965	monoatomic ion channel activity
GO:0005261	0.900	monoatomic cation channel activity
GO:0042802	0.310	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.982	cellular process
GO:0060294	0.815	cilium movement involved in cell motility
GO:0030317	0.803	flagellated sperm motility

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005886	1.000	plasma membrane
GO:0031090	0.994	organelle membrane
GO:0120025	0.987	plasma membrane bounded cell projection
GO:0098588	0.977	bounding membrane of organelle
GO:0098590	0.957	plasma membrane region
GO:0005622	0.809	intracellular anatomical structure
GO:0043231	0.803	intracellular membrane-bounded organelle
GO:0005929	0.684	cilium
GO:0005737	0.645	cytoplasm
GO:0031253	0.623	cell projection membrane
GO:0031514	0.582	motile cilium
GO:0060170	0.487	ciliary membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29251	1.000	2 H(+)(out) + Na(+)(in) = 2 H(+)(in) + Na(+)(out)

[back to server]