StarFunc result for job id Q4G0P3

User Input

>input (1400 residues)
MTSRRLEESMGAVQMGLVNMFKGFQSKVLPPLSPKVVTEEEVNRMLTPSEFLKEMSLTTE
QRLAKTRLMCRPQIIELLDMGETTHQKFSGIDLDQALFQPFPSEIIFQNYTPCEVYEVPL
ILRNNDKIPRLVKVVEESSPYFKVISPKDIGHKVAPGVPSIFRILFTPEENKDYAHTLTC
VTEREKFIVPIKARGARAILDFPDKLNFSTCPVKYSTQKILLVRNIGNKNAVFHIKTCRP
FSIEPAIGTLNVGESMQLEVEFEPQSVGDHSGRLIVCYDTGEKVFVSLYGAAIDMNIRLD
KNSLTIEKTYISLANQRTITIHNRSNIIAHFLWKVFATQQEEDREKYRACDDLIKEEKDE
TDEFFEECITDPLLREHLSVLSRTFANQRRLVQGDSKLFFNNVFTVEPLEGDVWPNSSAE
ITVYFNPLEAKLYQQTIYCDILGREIRLPLRIKGEGMGPKIHFNFELLDIGKVFTGSAHC
YEAILYNKGSIDALFNMTPPTSALGACFVFSPKEGIIEPSGVQAIQISFSSTILGNFEEE
FLVNVNGSPEPVKLTIRGCVIGPTFHFNVPALHFGDVSFGFPHTLICSLNNTSLIPMTYK
LRIPGDGLGHKSISYCEQHVDYKRPSWTKEEISSMKPKEFTISPDCGTIRPQGFAAIRVT
LCSNTVQKYELALVVDVEGIGEEVLALLITARCVVPALHLVNTEVDFGHCFLKYPYEKTL
QLANQDDLPGFYEVQPQVCEEVPTVLFSSPTPSGVISPSSTIHIPLVLETQVTGEHRSTV
YISIFGSQDPPLVCHLKSAGEGPVIYVHPNQVDFGNIYVLKDSSRILNLCNQSFIPAFFQ
AHMAHKKSLWTIEPNEGMVPPETDVQLALTANLNDTLTFKDCVILDIENSSTYRIPVQAS
GTGSTIVSDKPFAPELNLGAHFSLDTHYYHFKLINKGRRIQQLFWMNDSFRPQAKLSKKG
RVKKGHAHVQPQPSGSQEPRDPQSPVFHLHPASMELYPGQAIDVILEGYSATPRIVKEKL
VCHAIIGAQKGKSLVMAVNITCEFVAPLIQLSTKQLIYRLEKKPNSILKPDYQPLAIKNI
STLPVNLLLSTSGPFFICETDKSLLPATPEPIKLEIDEEKNLLIKFDPSYRNDLNNWVAE
EILAIKYVEHPQIDSLDLRGEVHYPNLSFETKELDFGCILNDTELIRYVTITNCSPLVVK
FRWFFLVNDEENQIRFVTLPKKPYSAPVSQMESIPATSEAASPPAILVTVESPEMDLNDF
VKTVLVDEDARPEEKELRKTKASSVISDEIKISSTEIERIYSSQSQVEDQESLQTCEQNE
MLSIGIEEVFDILPLFGVLQPHSSHQISFTFYGHANIIAQAKALCEVEEGPTYEITLKGE
ASLVNYSFDTKDIHYGLQLF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8JFU2	0.191	0.132	3.466E-72	2118	0.156	0.103	A8JFU2.pdb.gz	CFA65_CHLRE Cilia- and flagella-associated protein 65 (Fragment) OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP65 PE=1 SV=1
2	AFDB:Q38AM8	0.171	0.139	1.211E-63	1794	0.125	0.098	Q38AM8.pdb.gz	Q38AM8_TRYB2 Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3330 PE=4 SV=1
3	AFDB:Q6ZU64	0.181	0.138	1.601E-60	1925	0.138	0.100	Q6ZU64.pdb.gz	CFA65_HUMAN Cilia- and flagella-associated protein 65 OS=Homo sapiens OX=9606 GN=CFAP65 PE=1 SV=2
4	AFDB:Q3V0B4	0.187	0.147	2.315E-60	1847	0.134	0.102	Q3V0B4.pdb.gz	CFA65_MOUSE Cilia- and flagella-associated protein 65 OS=Mus musculus OX=10090 GN=Cfap65 PE=1 SV=1
5	AFDB:Q388P3	0.163	0.197	4.877E-51	1046	0.112	0.150	Q388P3.pdb.gz	Q388P3_TRYB2 Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.05.0270 PE=4 SV=1
6	PDB:7sqcO0	0.164	0.193	7.841E-51	1140	0.108	0.132	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
7	AFDB:Q9VAF5	0.124	0.107	2.188E-20	1706	0.080	0.066	Q9VAF5.pdb.gz	CAD99_DROME Cadherin-99C OS=Drosophila melanogaster OX=7227 GN=Cad99C PE=1 SV=2
8	PDB:7q5zA	0.100	0.103	9.695E-20	1344	0.076	0.079	7q5zA.pdb.gz
9	AFDB:P97603	0.088	0.089	5.504E-19	1377	0.084	0.085	P97603.pdb.gz	NEO1_RAT Neogenin (Fragment) OS=Rattus norvegicus OX=10116 GN=Neo1 PE=1 SV=1
10	PDB:7q1yA	0.092	0.093	6.122E-19	1374	0.065	0.066	7q1yA.pdb.gz
11	AFDB:B2RXR7	0.097	0.111	3.639E-18	1161	0.084	0.102	B2RXR7.pdb.gz	B2RXR7_MOUSE Pcdh9 protein OS=Mus musculus OX=10090 GN=Pcdh9 PE=2 SV=1
12	PDB:5a42A	0.081	0.073	4.647E-18	1597	0.083	0.073	5a42A.pdb.gz
13	AFDB:A0A0A6YWY8	0.098	0.110	1.003E-17	1203	0.071	0.082	A0A0A6YWY8.pdb.gz	A0A0A6YWY8_MOUSE Protocadherin 9 OS=Mus musculus OX=10090 GN=Pcdh9 PE=1 SV=1
14	AFDB:O70535	0.085	0.099	1.451E-16	1093	0.089	0.114	O70535.pdb.gz	LIFR_RAT Leukemia inhibitory factor receptor OS=Rattus norvegicus OX=10116 GN=Lifr PE=2 SV=1
15	PDB:7sqcO1	0.107	0.187	3.221E-16	673	0.044	0.092	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
16	PDB:6h03A	0.083	0.092	1.691E-15	1223	0.055	0.063	6h03A.pdb.gz
17	PDB:7vonA	0.095	0.095	3.701E-15	1399	0.068	0.068	7vonA.pdb.gz
18	PDB:4lnvA	0.079	0.085	1.284E-14	1276	0.066	0.072	4lnvA.pdb.gz
19	PDB:4bxsV	0.065	0.069	3.538E-14	1262	0.068	0.075	4bxsV.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
20	PDB:7nycA	0.071	0.068	3.879E-14	1542	0.078	0.071	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q4G0P3	0.0	2892	5121	1.000	0.273	HYDIN_HUMAN Hydrocephalus-inducing protein homolog OS=Homo sapiens OX=9606 GN=HYDIN PE=1 SV=3
2	Q80W93	0.0	2201	5154	0.763	0.207	HYDIN_MOUSE Hydrocephalus-inducing protein OS=Mus musculus OX=10090 GN=Hydin PE=1 SV=2
3	Q583L9	2.98e-119	416	4521	0.222	0.069	Q583L9_TRYB2 Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.5F5.940 PE=4 SV=1
4	Q9Y238	4.38e-25	116	1755	0.124	0.099	DLEC1_HUMAN Deleted in lung and esophageal cancer protein 1 OS=Homo sapiens OX=9606 GN=DLEC1 PE=1 SV=2
5	A8JFU2	1.44e-09	65.5	2118	0.034	0.022	CFA65_CHLRE Cilia- and flagella-associated protein 65 (Fragment) OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP65 PE=1 SV=1
6	Q6ZU64	1.09e-08	62.8	1925	0.039	0.028	CFA65_HUMAN Cilia- and flagella-associated protein 65 OS=Homo sapiens OX=9606 GN=CFAP65 PE=1 SV=2
7	Q38AM8	1.13e-08	62.4	1794	0.034	0.027	Q38AM8_TRYB2 Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3330 PE=4 SV=1
8	Q3V0B4	2.17e-08	61.6	1847	0.032	0.024	CFA65_MOUSE Cilia- and flagella-associated protein 65 OS=Mus musculus OX=10090 GN=Cfap65 PE=1 SV=1
9	Q8BLA1	1.22e-06	55.5	635	0.038	0.083	DLEC1_MOUSE Deleted in lung and esophageal cancer protein 1 homolog OS=Mus musculus OX=10090 GN=Dlec1 PE=1 SV=1
10	Q583U1	5.28e-06	53.9	2728	0.044	0.022	Q583U1_TRYB2 Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.3D8.330 PE=4 SV=1
11	D4P3R7	9.66e-05	49.7	1940	0.046	0.034	CFA74_CHLRE Cilia- and flagella-associated protein 74 OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP74 PE=1 SV=1
12	A8J6X7	0.011	42.7	645	0.029	0.062	PCDP1_CHLRE Cilia- and flagella-associated protein 221 homolog OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP221 PE=1 SV=1
13	Q388P3	0.050	40.8	1046	0.032	0.043	Q388P3_TRYB2 Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.05.0270 PE=4 SV=1
14	A9Q751	0.060	40.4	836	0.024	0.039	PCDP1_MOUSE Cilia- and flagella-associated protein 221 OS=Mus musculus OX=10090 GN=Cfap221 PE=1 SV=1
15	O17099	0.20	38.1	374	0.016	0.059	O17099_CAEEL Major sperm protein OS=Caenorhabditis elegans OX=6239 GN=CELE_F42G2.5 PE=1 SV=1
16	A0A0G2JEB6	0.23	38.5	3184	0.054	0.024	CFA47_MOUSE Cilia and flagella-associated protein 47 OS=Mus musculus OX=10090 GN=Cfap47 PE=1 SV=2
17	Q9LVU1	0.95	35.4	220	0.011	0.073	VAP21_ARATH Vesicle-associated protein 2-1 OS=Arabidopsis thaliana OX=3702 GN=PVA21 PE=1 SV=1
18	Q6ZTR5	1.0	36.6	3187	0.026	0.012	CFA47_HUMAN Cilia- and flagella-associated protein 47 OS=Homo sapiens OX=9606 GN=CFAP47 PE=1 SV=5
19	Q72DA0	1.1	35.8	373	0.019	0.072	HIS8_DESVH Histidinol-phosphate aminotransferase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=hisC PE=1 SV=1
20	Q6P2K8	1.4	35.8	640	0.015	0.033	Q6P2K8_MOUSE Cep192 protein OS=Mus musculus OX=10090 GN=Cep192 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15780 ASH	2.8e-32	122.1	Abnormal spindle-like microcephaly-assoc'd, ASPM-SPD-2-Hydin
2	PF02368 Big_2	1.6e+02	13.6	Bacterial Ig-like domain (group 2)
3	PF07610 DUF1573	0.0011	30.2	Protein of unknown function (DUF1573)
4	PF17517 IgGFc_binding	57	14.5	IgGFc binding protein
5	PF00635 Motile_Sperm	1.3e-08	46.1	MSP (Major sperm protein) domain
6	PF14646 MYCBPAP	11	16.5	MYCBP-associated protein family
7	PF14874 PapD-like	9.4e-15	66.0	Flagellar-associated PapD-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377197

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361238	0.851	Radial spoke head 9 homolog
2	9606.ENSP00000405708	0.851	Coiled-coil domain-containing protein 39
3	9606.ENSP00000363436	0.848	G protein-regulated inducer of neurite outgrowth 2
4	9606.ENSP00000229554	0.833	Radial spoke head protein 4 homolog A
5	9606.ENSP00000339449	0.825	Cilia- and flagella-associated protein 52
6	9606.ENSP00000373347	0.816	SLIT-ROBO Rho GTPase-activating protein 3
7	9606.ENSP00000474456	0.816	Neuroblastoma breakpoint family member 1
8	9606.ENSP00000320401	0.815	UDP-glucuronosyltransferase 2B17
9	9606.ENSP00000320324	0.814	Puromycin-sensitive aminopeptidase
10	9606.ENSP00000478609	0.814	Neuroblastoma breakpoint family member 1
11	9606.ENSP00000306129	0.811	D(1B) dopamine receptor
12	9606.ENSP00000459615	0.811	SLIT-ROBO Rho GTPase-activating protein 2
13	9606.ENSP00000480538	0.796	Dynein intermediate chain 1, axonemal
14	9606.ENSP00000380679	0.790	Coiled-coil domain-containing protein 40
15	9606.ENSP00000291536	0.789	Radial spoke head 1 homolog
16	9606.ENSP00000460070	0.764	General transcription factor II-I
17	9606.ENSP00000484634	0.760	Protein tilB homolog
18	9606.ENSP00000475939	0.752	Dynein heavy chain 11, axonemal
19	9606.ENSP00000288710	0.741	Dynein regulatory complex protein 1
20	9606.ENSP00000318429	0.733	Coiled-coil domain-containing protein 114

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007017	0.996	microtubule-based process
GO:0032502	0.995	developmental process
GO:0032501	0.994	multicellular organismal process
GO:0048856	0.994	anatomical structure development
GO:0070925	0.993	organelle assembly
GO:0007010	0.990	cytoskeleton organization
GO:0044782	0.988	cilium organization
GO:0030154	0.984	cell differentiation
GO:0001578	0.965	microtubule bundle formation
GO:0035082	0.956	axoneme assembly
GO:0048513	0.953	animal organ development
GO:0030855	0.943	epithelial cell differentiation
GO:0007417	0.917	central nervous system development
GO:0060322	0.911	head development
GO:0003341	0.894	cilium movement
GO:0021591	0.858	ventricular system development
GO:0048468	0.832	cell development
GO:0060541	0.606	respiratory system development
GO:0002064	0.594	epithelial cell development
GO:0060438	0.555	trachea development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005929	1.000	cilium
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0005930	0.989	axoneme

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]