StarFunc result for job id Q4G0S4

User Input

>input (542 residues)
MQTSAMALLARILRAGLRPAPERGGLLGGGAPRRPQPAGARLPAGARAEDKGAGRPGSPP
GGGRAEGPRSLAAMPGPRTLANLAEFFCRDGFSRIHEIQQKHTREYGKIFKSHFGPQFVV
SIADRDMVAQVLRAEGAAPQRANMESWREYRDLRGRATGLISAEGEQWLKMRSVLRQRIL
KPKDVAIYSGEVNQVIADLIKRIYLLRSQAEDGETVTNVNDLFFKYSMEGVATILYESRL
GCLENSIPQLTVEYIEALELMFSMFKTSMYAGAIPRWLRPFIPKPWREFCRSWDGLFKFS
QIHVDNKLRDIQYQMDRGRRVSGGLLTYLFLSQALTLQEIYANVTEMLLAGVDTTSFTLS
WTVYLLARHPEVQQTVYREIVKNLGERHVPTAADVPKVPLVRALLKETLRLFPVLPGNGR
VTQEDLVIGGYLIPKGTQLALCHYATSYQDENFPRAKEFRPERWLRKGDLDRVDNFGSIP
FGHGVRSCIGRRIAELEIHLVVIQLLQHFEIKTSSQTNAVHAKTHGLLTPGGPIHVRFVN
RK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q4G0S4	1.000	1.000	7.775E-85	542	1.000	1.000	Q4G0S4.pdb.gz	C27C1_HUMAN Cytochrome P450 27C1 OS=Homo sapiens OX=9606 GN=CYP27C1 PE=1 SV=3
2	AFDB:A0A140LGN8	0.850	0.909	7.669E-46	506	0.365	0.391	A0A140LGN8.pdb.gz
3	AFDB:P17178	0.849	0.863	5.617E-45	533	0.373	0.379	P17178.pdb.gz	CP27A_RAT Sterol 26-hydroxylase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cyp27a1 PE=1 SV=1
4	AFDB:O35084	0.830	0.885	8.135E-45	507	0.365	0.391	O35084.pdb.gz	CP27B_MOUSE 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Mus musculus OX=10090 GN=Cyp27b1 PE=1 SV=2
5	AFDB:Q9DBG1	0.850	0.864	3.264E-44	533	0.354	0.360	Q9DBG1.pdb.gz	CP27A_MOUSE Sterol 26-hydroxylase, mitochondrial OS=Mus musculus OX=10090 GN=Cyp27a1 PE=1 SV=1
6	AFDB:O15528	0.829	0.883	6.537E-44	508	0.376	0.402	O15528.pdb.gz	CP27B_HUMAN 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Homo sapiens OX=9606 GN=CYP27B1 PE=1 SV=1
7	AFDB:Q02318	0.847	0.864	1.986E-43	531	0.349	0.356	Q02318.pdb.gz	CP27A_HUMAN Sterol 26-hydroxylase, mitochondrial OS=Homo sapiens OX=9606 GN=CYP27A1 PE=1 SV=1
8	AFDB:O73684	0.788	0.838	5.597E-38	508	0.293	0.313	O73684.pdb.gz	O73684_CHICK 25-hydroxyvitamin D3 24-hydroxylase OS=Gallus gallus OX=9031 GN=cP450cc24 PE=2 SV=1
9	AFDB:Q07973	0.794	0.835	7.838E-37	514	0.308	0.325	Q07973.pdb.gz	CP24A_HUMAN 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Homo sapiens OX=9606 GN=CYP24A1 PE=1 SV=2
10	AFDB:P14137	0.816	0.840	5.481E-36	526	0.286	0.295	P14137.pdb.gz	CP11A_RAT Cholesterol side-chain cleavage enzyme, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cyp11a1 PE=1 SV=1
11	PDB:3k9vA	0.788	0.914	8.017E-33	464	0.269	0.315	3k9vA.pdb.gz	Crystal structure of CYP24A1, a mitochondrial cytochrome P450 involved in vitamin D metabolism.
12	PDB:3na1A	0.805	0.919	1.606E-32	472	0.253	0.290	3na1A.pdb.gz	Structural basis for pregnenolone biosynthesis by the mitochondrial monooxygenase system.
13	PDB:3mzsA	0.798	0.914	1.626E-31	470	0.256	0.296	3mzsA.pdb.gz	Structural Basis for Three-step Sequential Catalysis by the Cholesterol Side Chain Cleavage Enzyme CYP11A1.
14	PDB:7m8iA	0.780	0.741	1.263E-29	572	0.266	0.252	7m8iA.pdb.gz	Structural and functional insights into aldosterone synthase interaction with its redox partner protein adrenodoxin.
15	PDB:5te8B	0.723	0.823	1.823E-22	471	0.242	0.278	5te8B.pdb.gz	Structural basis for regiospecific midazolam oxidation by human cytochrome P450 3A4.
16	PDB:7mk8B	0.721	0.832	3.487E-22	465	0.216	0.252	7mk8B.pdb.gz	Structural Basis for the Diminished Ligand Binding and Catalytic Ability of Human Fetal-Specific CYP3A7.
17	PDB:5veuC	0.718	0.823	5.289E-22	469	0.244	0.281	5veuC.pdb.gz	The X-Ray Crystal Structure of the Human Mono-Oxygenase Cytochrome P450 3A5-Ritonavir Complex Reveals Active Site Differences between P450s 3A4 and 3A5.
18	PDB:2j0dB	0.683	0.821	8.803E-22	445	0.229	0.279	2j0dB.pdb.gz	Structural Basis for Ligand Promiscuity in Cytochrome P450 3A4
19	PDB:4nz2A	0.692	0.797	2.675E-21	464	0.164	0.192	4nz2A.pdb.gz	Structure-based ligand design to overcome CYP inhibition in drug discovery projects.
20	PDB:5veuL	0.688	0.822	3.219E-21	448	0.234	0.283	5veuL.pdb.gz	The X-Ray Crystal Structure of the Human Mono-Oxygenase Cytochrome P450 3A5-Ritonavir Complex Reveals Active Site Differences between P450s 3A4 and 3A5.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q4G0S4	0.0	1113	542	1.000	1.000	C27C1_HUMAN Cytochrome P450 27C1 OS=Homo sapiens OX=9606 GN=CYP27C1 PE=1 SV=3
2	A0A097HUX0	2.26e-148	437	505	0.380	0.408	A0A097HUX0_DANRE 25-hydroxyvitamin D-1alpha-hydroxylase OS=Danio rerio OX=7955 GN=cyp27b1 PE=2 SV=1
3	P17178	9.88e-126	380	533	0.349	0.355	CP27A_RAT Sterol 26-hydroxylase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cyp27a1 PE=1 SV=1
4	O15528	6.77e-124	375	508	0.375	0.400	CP27B_HUMAN 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Homo sapiens OX=9606 GN=CYP27B1 PE=1 SV=1
5	Q02318	9.80e-123	372	531	0.339	0.347	CP27A_HUMAN Sterol 26-hydroxylase, mitochondrial OS=Homo sapiens OX=9606 GN=CYP27A1 PE=1 SV=1
6	Q9DBG1	1.62e-120	367	533	0.358	0.364	CP27A_MOUSE Sterol 26-hydroxylase, mitochondrial OS=Mus musculus OX=10090 GN=Cyp27a1 PE=1 SV=1
7	O35132	9.10e-117	356	501	0.363	0.393	CP27B_RAT 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cyp27b1 PE=2 SV=2
8	O35084	3.56e-114	350	507	0.360	0.385	CP27B_MOUSE 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Mus musculus OX=10090 GN=Cyp27b1 PE=1 SV=2
9	Q07973	1.14e-86	279	514	0.290	0.305	CP24A_HUMAN 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Homo sapiens OX=9606 GN=CYP24A1 PE=1 SV=2
10	Q64441	1.01e-85	276	514	0.286	0.302	CP24A_MOUSE 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Mus musculus OX=10090 GN=Cyp24a1 PE=2 SV=1
11	Q09128	4.73e-83	269	514	0.269	0.284	CP24A_RAT 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cyp24a1 PE=1 SV=1
12	O73684	1.05e-82	268	508	0.288	0.307	O73684_CHICK 25-hydroxyvitamin D3 24-hydroxylase OS=Gallus gallus OX=9031 GN=cP450cc24 PE=2 SV=1
13	P14137	2.51e-71	239	526	0.279	0.287	CP11A_RAT Cholesterol side-chain cleavage enzyme, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cyp11a1 PE=1 SV=1
14	Q7SYJ6	4.47e-70	235	509	0.264	0.281	Q7SYJ6_DANRE Cholesterol side-chain cleavage enzyme, mitochondrial OS=Danio rerio OX=7955 GN=cyp11a1.1 PE=1 SV=1
15	P00189	1.09e-69	234	520	0.288	0.300	CP11A_BOVIN Cholesterol side-chain cleavage enzyme, mitochondrial OS=Bos taurus OX=9913 GN=CYP11A1 PE=1 SV=1
16	Q9QZ82	7.39e-68	229	526	0.273	0.281	CP11A_MOUSE Cholesterol side-chain cleavage enzyme, mitochondrial OS=Mus musculus OX=10090 GN=Cyp11a1 PE=1 SV=1
17	P05108	4.42e-64	219	521	0.268	0.278	CP11A_HUMAN Cholesterol side-chain cleavage enzyme, mitochondrial OS=Homo sapiens OX=9606 GN=CYP11A1 PE=1 SV=2
18	Q90X62	9.45e-58	198	351	0.212	0.328	Q90X62_CHICK Mitochondrial vitamin D 24-hydroxylase variant OS=Gallus gallus OX=9031 GN=CYP24 PE=2 SV=2
19	A1XRK1	3.13e-56	198	518	0.251	0.263	A1XRK1_DANRE Cytochrome P450, family 11, subfamily C, polypeptide 1 OS=Danio rerio OX=7955 GN=cyp11b2 PE=1 SV=1
20	Q3TG86	1.02e-55	197	501	0.240	0.259	Q3TG86_MOUSE steroid 11beta-monooxygenase OS=Mus musculus OX=10090 GN=Cyp11b1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00067 p450	2.7e-91	318.3	Cytochrome P450

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 27679.XP_003931663.2

Rank	PPI partner	STRING score	Description
1	27679.XP_010328294.1	0.933	All-trans-retinol 13,14-reductase
2	27679.XP_003922435.1	0.932	Belongs to the cytochrome P450 family.
3	27679.XP_003942676.1	0.910	Belongs to the short-chain dehydrogenases/reductases (SDR) family
4	27679.XP_010344335.1	0.910	Epidermal retinol dehydrogenase 2
5	27679.XP_010347976.1	0.910	Retinol dehydrogenase 8
6	27679.XP_003924346.1	0.909	Dehydrogenase/reductase SDR family member 4
7	27679.XP_003929575.1	0.909	Alcohol dehydrogenase 4
8	27679.XP_010333491.1	0.909	Belongs to the short-chain dehydrogenases/reductases (SDR) family
9	27679.XP_010333492.1	0.909	Belongs to the short-chain dehydrogenases/reductases (SDR) family
10	27679.XP_003929569.1	0.908	Alcohol dehydrogenase class 4 mu/sigma chain isoform X1
11	27679.XP_003929571.1	0.908	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 9 ESTs, 42 Proteins, and 60% coverage of the annotated genomic feature by RNAseq alignments
12	27679.XP_003929572.1	0.908	Alcohol dehydrogenase 1C
13	27679.XP_010338431.1	0.908	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: substituted 1 base at 1 genomic stop codon
14	27679.XP_010338463.1	0.908	Alcohol dehydrogenase 1B
15	27679.XP_003921948.1	0.907	Dehydrogenase/reductase SDR family member 9
16	27679.XP_003926499.1	0.907	Belongs to the short-chain dehydrogenases/reductases (SDR) family
17	27679.XP_003926501.1	0.907	Belongs to the short-chain dehydrogenases/reductases (SDR) family
18	27679.XP_003929577.2	0.907	Belongs to the zinc-containing alcohol dehydrogenase family. Class-III subfamily
19	27679.XP_010328255.1	0.903	Diacylglycerol O-acyltransferase 1
20	27679.XP_003920338.1	0.900	Patatin-like phospholipase domain-containing protein 4 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016705	1.000	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0004497	1.000	monooxygenase activity
GO:0005488	0.966	binding
GO:0043167	0.509	ion binding
GO:0005515	0.402	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006629	0.997	lipid metabolic process
GO:1901615	0.996	organic hydroxy compound metabolic process
GO:0009987	0.989	cellular process
GO:0044281	0.968	small molecule metabolic process
GO:0044237	0.933	cellular metabolic process
GO:0006066	0.926	alcohol metabolic process
GO:1901360	0.846	organic cyclic compound metabolic process
GO:0008202	0.796	steroid metabolic process
GO:1901576	0.686	organic substance biosynthetic process
GO:0008610	0.673	lipid biosynthetic process
GO:0006694	0.503	steroid biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005737	0.810	cytoplasm
GO:0016020	0.796	membrane
GO:0005739	0.597	mitochondrion
GO:0031090	0.392	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.14.-.-	1.000	Acting on paired donors, with incorporation or reduction of molecular oxygen. The oxygen incorporated need not be derived from O2.

[back to server]