StarFunc result for job id Q4G0T1

User Input

>input (1027 residues)
MRAALWTLGLGPLLLNLWAVPIGGPGALRLAYRHSTCDGVVLVRHHGAWGYVCNQEWTLA
EASVVCRQLGCGPAVGAPKYVPLPGEMAQPWLHNVSCRGNESSLWECSLGSWCQSPCPHA
WVVVALCSNGTFRELRLVKGRSPCAGLPEIRNVNGVDRLCVLHVEEAMVFCRELGCGPVL
QAPRRDVGVVRKYLACRGTEPTIRSCRLDNNFRSGCDLRLDAEVVCSGHTEARLVGGEHP
CAGRLEVTWGTVCDAALDLATAHVVCRELQCGAVVSTPEGARFGRGSGPVWTEAFRCAGN
ESLLFHCPRGRGSQCGHGHDAGLRCSEFRMVNGSSSCEGRVEFQVQGSWAPLCATHWDIA
DATVLCHQLNCGNAVAAPGGGHFGDGDAAIWPDAFHCEGTESYLWNCPVSTLGAPACAPG
NTASAVCSGLAHALRLREGQSRCDGRVEVSLDGVWGRVLDDAWDLRGAGVVCRQLGCRGA
QQAYDAPAPSRGSVQVALSRVRCLGTETRLTQCNVSATLQEPAGTSRDAGVVCSGEVGTA
SPMARRHGIPGALTLSLHREPQGAAGRGAGALHGGAWGTVCDDAWDLRDAHVVCRQLGCG
RALSALGAAHFGAGAGRIWLDELGCQGHESALWQCPSAGWGRHDWRHKEDAGVFCSESVA
LRLRGGTCCCAGWLDVFYNGTWGAMCSNALKDLSLSIICKQLGCGVWGVGLAGEQALPLC
GHRDRLGGQHRVPQAAQLHSVAMPFPPMAPALLRPSRAGLSEDRPQAAGEPLNCSSWLGC
PEEGALRVRGGEDRCSGRVELWHAGSWGTVCDDGWDLADAEVVCRQLGCGRAVAALGAAA
FGPGSGPVWLDEVGCRGSEASLWGCPAERWGRGDRAHEEDAGVRCWEPGPGPPLPAAPFR
TFWVVSVVLGSLLGLLLLGLMAFLILPRVTQAMQRGLGRSEVSPGEAIYDVIGEMPPAGL
YEEIMEAEAVLQDEEDGSVVKVDTEAAVSGEVSNLLEGQSIRAEGGHSRPVSQGYDEAAF
PLEEMTL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A1B0GSB0	0.596	0.616	0.000	991	0.611	0.634	A0A1B0GSB0.pdb.gz	A0A1B0GSB0_MOUSE Scavenger receptor family member expressed on T cells 1 OS=Mus musculus OX=10090 GN=Scart1 PE=1 SV=1
2	AFDB:B3F5L4	0.371	0.349	0.000	1112	0.515	0.476	B3F5L4.pdb.gz	B3F5L4_MOUSE SCART2 splice variant A OS=Mus musculus OX=10090 GN=Scart2 PE=1 SV=1
3	AFDB:Q4G0T1	1.000	1.000	0.000	1027	1.000	1.000	Q4G0T1.pdb.gz	SRCRM_HUMAN Scavenger receptor cysteine-rich domain-containing protein SCART1 OS=Homo sapiens OX=9606 GN=SCART1 PE=1 SV=2
4	AFDB:A0A0G2JVY2	0.191	0.180	1.610E-79	1111	0.343	0.317	A0A0G2JVY2.pdb.gz	A0A0G2JVY2_RAT CD163 molecule OS=Rattus norvegicus OX=10116 GN=Cd163 PE=1 SV=2
5	AFDB:Q86VB7	0.166	0.152	1.647E-78	1156	0.351	0.311	Q86VB7.pdb.gz	C163A_HUMAN Scavenger receptor cysteine-rich type 1 protein M130 OS=Homo sapiens OX=9606 GN=CD163 PE=1 SV=2
6	AFDB:Q8CIZ5	0.131	0.102	7.914E-44	1418	0.235	0.170	Q8CIZ5.pdb.gz	DMBT1_RAT Deleted in malignant brain tumors 1 protein OS=Rattus norvegicus OX=10116 GN=Dmbt1 PE=1 SV=1
7	AFDB:O43866	0.131	0.310	4.512E-28	347	0.129	0.380	O43866.pdb.gz	CD5L_HUMAN CD5 antigen-like OS=Homo sapiens OX=9606 GN=CD5L PE=1 SV=1
8	AFDB:O08762	0.122	0.156	9.026E-26	761	0.135	0.183	O08762.pdb.gz	NETR_MOUSE Neurotrypsin OS=Mus musculus OX=10090 GN=Prss12 PE=1 SV=1
9	AFDB:P30204	0.103	0.227	5.606E-11	458	0.060	0.135	P30204.pdb.gz	MSRE_MOUSE Macrophage scavenger receptor types I and II OS=Mus musculus OX=10090 GN=Msr1 PE=1 SV=3
10	AFDB:Q96JK4	0.109	0.141	8.185E-11	782	0.062	0.082	Q96JK4.pdb.gz	HIPL1_HUMAN HHIP-like protein 1 OS=Homo sapiens OX=9606 GN=HHIPL1 PE=1 SV=2
11	PDB:2xrcC	0.084	0.177	1.339E-4	454	0.031	0.070	2xrcC.pdb.gz	Structural Basis for Complement Factor I Control and its Disease-Associated Sequence Polymorphisms.
12	PDB:2xrcB	0.092	0.187	5.175E-4	485	0.032	0.068	2xrcB.pdb.gz	Structural Basis for Complement Factor I Control and its Disease-Associated Sequence Polymorphisms.
13	PDB:7np7B4	0.041	0.073	3.122	480	0.030	0.065	7np7B4.pdb.gz
14	PDB:3j6bP	0.050	0.183	3.875	207	0.013	0.063	3j6bP.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
15	PDB:5u0pF	0.026	0.115	5.972	195	0.008	0.041	5u0pF.pdb.gz
16	PDB:5iklB	0.027	0.049	6.304	514	0.011	0.021	5iklB.pdb.gz
17	PDB:1t9mA	0.030	0.122	7.024	204	0.008	0.039	1t9mA.pdb.gz	Structure of the phenazine biosynthesis enzyme PhzG.
18	PDB:6o15A	0.038	0.082	7.826	355	0.014	0.039	6o15A.pdb.gz	On the structure and function of Escherichia coli YjhC: An oxidoreductase involved in bacterial sialic acid metabolism.
19	PDB:4c3hG	0.035	0.077	8.261	259	0.013	0.050	4c3hG.pdb.gz	Crystal Structure of the 14-Subunit RNA Polymerase I
20	PDB:4f1iA	0.030	0.072	8.261	328	0.007	0.021	4f1iA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1B0GSB0	0.0	1141	991	0.606	0.628	A0A1B0GSB0_MOUSE Scavenger receptor family member expressed on T cells 1 OS=Mus musculus OX=10090 GN=Scart1 PE=1 SV=1
2	B3F5L4	0.0	811	1112	0.488	0.451	B3F5L4_MOUSE SCART2 splice variant A OS=Mus musculus OX=10090 GN=Scart2 PE=1 SV=1
3	B3F5L5	0.0	917	996	0.524	0.540	B3F5L5_MOUSE SCART2 splice variant B OS=Mus musculus OX=10090 GN=Scart2 PE=1 SV=1
4	Q4G0T1	0.0	2035	1027	1.000	1.000	SRCRM_HUMAN Scavenger receptor cysteine-rich domain-containing protein SCART1 OS=Homo sapiens OX=9606 GN=SCART1 PE=1 SV=2
5	Q86VB7	0.0	561	1156	0.345	0.306	C163A_HUMAN Scavenger receptor cysteine-rich type 1 protein M130 OS=Homo sapiens OX=9606 GN=CD163 PE=1 SV=2
6	Q8BIC8	0.0	1134	991	0.604	0.626	Q8BIC8_MOUSE SRCR domain-containing protein OS=Mus musculus OX=10090 GN=Scart1 PE=2 SV=1
7	Q8CGY7	0.0	1143	989	0.606	0.629	Q8CGY7_MOUSE Scavenger receptor cysteine-rich type 1 protein CD163c-alpha OS=Mus musculus OX=10090 GN=Scart1 PE=1 SV=1
8	A0A8I5ZQF0	9.82e-174	539	1109	0.331	0.307	A0A8I5ZQF0_RAT CD163 molecule OS=Rattus norvegicus OX=10116 GN=Cd163 PE=1 SV=1
9	D3Z9U2	1.55e-173	539	1110	0.331	0.306	D3Z9U2_RAT CD163 molecule OS=Rattus norvegicus OX=10116 GN=Cd163 PE=4 SV=2
10	A0A0G2JVY2	2.89e-173	539	1151	0.331	0.295	A0A0G2JVY2_RAT CD163 molecule OS=Rattus norvegicus OX=10116 GN=Cd163 PE=1 SV=2
11	Q9UGM3	5.91e-164	536	2413	0.371	0.158	DMBT1_HUMAN Deleted in malignant brain tumors 1 protein OS=Homo sapiens OX=9606 GN=DMBT1 PE=1 SV=2
12	Q8C9T4	5.10e-137	421	446	0.221	0.509	Q8C9T4_MOUSE SRCR domain-containing protein OS=Mus musculus OX=10090 GN=Scart2 PE=2 SV=1
13	Q60997	3.73e-129	435	2085	0.316	0.156	DMBT1_MOUSE Deleted in malignant brain tumors 1 protein OS=Mus musculus OX=10090 GN=Dmbt1 PE=1 SV=2
14	Q8BV57	3.20e-68	252	1371	0.216	0.162	SRCRL_MOUSE Soluble scavenger receptor cysteine-rich domain-containing protein SSC5D OS=Mus musculus OX=10090 GN=Ssc5d PE=1 SV=1
15	P56730	1.12e-63	234	875	0.169	0.199	NETR_HUMAN Neurotrypsin OS=Homo sapiens OX=9606 GN=PRSS12 PE=2 SV=2
16	Q8CIZ5	4.86e-61	230	1418	0.162	0.117	DMBT1_RAT Deleted in malignant brain tumors 1 protein OS=Rattus norvegicus OX=10116 GN=Dmbt1 PE=1 SV=1
17	A1L4H1	7.91e-60	226	1573	0.184	0.120	SRCRL_HUMAN Soluble scavenger receptor cysteine-rich domain-containing protein SSC5D OS=Homo sapiens OX=9606 GN=SSC5D PE=1 SV=3
18	O08762	2.18e-47	184	761	0.117	0.158	NETR_MOUSE Neurotrypsin OS=Mus musculus OX=10090 GN=Prss12 PE=1 SV=1
19	O43866	2.90e-47	174	347	0.119	0.352	CD5L_HUMAN CD5 antigen-like OS=Homo sapiens OX=9606 GN=CD5L PE=1 SV=1
20	Q9QWK4	6.36e-46	171	352	0.112	0.327	CD5L_MOUSE CD5 antigen-like OS=Mus musculus OX=10090 GN=Cd5l PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00530 SRCR	7e-159	528.6	Scavenger receptor cysteine-rich domain
2	PF15494 SRCR_2	1.9e-10	52.6	Scavenger receptor cysteine-rich domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000004637

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000018843	0.761	Haptoglobin-related protein
2	9593.ENSGGOP00000021192	0.697	Glycoprotein 2 (zymogen granule membrane)
3	9593.ENSGGOP00000013944	0.681	Interleukin 10
4	9593.ENSGGOP00000025312	0.575	CD68 molecule
5	9593.ENSGGOP00000010546	0.568	Tetraspanin
6	9593.ENSGGOP00000004414	0.539	Uncharacterized protein
7	9593.ENSGGOP00000026085	0.539	Uncharacterized protein
8	9593.ENSGGOP00000008755	0.534	Surfactant protein D
9	9593.ENSGGOP00000001827	0.503	Myosin, heavy chain 9, non-muscle

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0038024	0.853	cargo receptor activity
GO:0005044	0.464	scavenger receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.864	multicellular organismal process
GO:0045321	0.762	leukocyte activation
GO:0048856	0.659	anatomical structure development
GO:0065007	0.596	biological regulation
GO:0050789	0.545	regulation of biological process
GO:0046649	0.542	lymphocyte activation
GO:0050794	0.493	regulation of cellular process
GO:0030098	0.396	lymphocyte differentiation
GO:0048522	0.346	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0005737	0.966	cytoplasm
GO:0016020	0.965	membrane
GO:0005886	0.945	plasma membrane
GO:0098862	0.779	cluster of actin-based cell projections
GO:0005903	0.459	brush border
GO:0005576	0.426	extracellular region
GO:0005615	0.408	extracellular space
GO:0043227	0.401	membrane-bounded organelle
GO:0043229	0.322	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]