StarFunc result for job id Q4G0X4

User Input

>input (260 residues)
MSDPITLNVGGKLYTTSLATLTSFPDSMLGAMFSGKMPTKRDSQGNCFIDRDGKVFRYIL
NFLRTSHLDLPEDFQEMGLLRREADFYQVQPLIEALQEKEVELSKAEKNAMLNITLNQRV
QTVHFTVREAPQIYSLSSSSMEVFNANIFSTSCLFLKLLGSKLFYCSNGNLSSITSHLQD
PNHLTLDWVANVEGLPEEEYTKQNLKRLWVVPANKQINSFQVFVEEVLKIALSDGFCIDS
SHPHALDFMNNKIIRLIRYR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q4G0X4	1.000	1.000	1.041E-54	260	1.000	1.000	Q4G0X4.pdb.gz	KCD21_HUMAN BTB/POZ domain-containing protein KCTD21 OS=Homo sapiens OX=9606 GN=KCTD21 PE=1 SV=1
2	AFDB:Q8K485	0.483	0.537	1.019E-22	232	0.354	0.397	Q8K485.pdb.gz	KCD11_MOUSE BTB/POZ domain-containing protein KCTD11 OS=Mus musculus OX=10090 GN=Kctd11 PE=1 SV=1
3	AFDB:Q693B1	0.478	0.532	2.922E-22	232	0.365	0.409	Q693B1.pdb.gz	KCD11_HUMAN BTB/POZ domain-containing protein KCTD11 OS=Homo sapiens OX=9606 GN=KCTD11 PE=1 SV=1
4	AFDB:Q8NC69	0.386	0.423	3.603E-18	237	0.308	0.338	Q8NC69.pdb.gz	KCTD6_HUMAN BTB/POZ domain-containing protein KCTD6 OS=Homo sapiens OX=9606 GN=KCTD6 PE=1 SV=2
5	AFDB:Q8N5I3	0.539	0.519	1.437E-16	272	0.238	0.228	Q8N5I3.pdb.gz	KCNRG_HUMAN Potassium channel regulatory protein OS=Homo sapiens OX=9606 GN=KCNRG PE=1 SV=1
6	AFDB:Q5XJ34	0.418	0.423	1.779E-15	257	0.285	0.288	Q5XJ34.pdb.gz	KC15L_DANRE BTB/POZ domain-containing protein kctd15-like OS=Danio rerio OX=7955 GN=kctd15l PE=1 SV=1
7	AFDB:Q8K0E1	0.403	0.372	3.012E-15	283	0.277	0.254	Q8K0E1.pdb.gz	KCD15_MOUSE BTB/POZ domain-containing protein KCTD15 OS=Mus musculus OX=10090 GN=Kctd15 PE=1 SV=1
8	AFDB:A0A2U3U043	0.401	0.132	2.782E-14	865	0.269	0.081	A0A2U3U043.pdb.gz	A0A2U3U043_HUMAN Potassium channel tetramerization domain containing 1 OS=Homo sapiens OX=9606 GN=KCTD1 PE=1 SV=1
9	AFDB:Q9VDH3	0.421	0.475	6.691E-14	228	0.246	0.281	Q9VDH3.pdb.gz	Q9VDH3_DROME GH08630p OS=Drosophila melanogaster OX=7227 GN=Ktl PE=1 SV=1
10	AFDB:D5SHR0	0.397	0.283	2.889E-13	367	0.262	0.185	D5SHR0.pdb.gz	TIWAZ_DROME BTB/POZ domain-containing protein Tiwaz OS=Drosophila melanogaster OX=7227 GN=twz PE=2 SV=1
11	PDB:6sgaFS	0.295	0.279	7.465E-9	277	0.177	0.166	6sgaFS.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
12	PDB:7w6sB	0.329	0.200	1.936E-6	448	0.127	0.074	7w6sB.pdb.gz
13	PDB:7sizB	0.340	0.268	3.475E-6	334	0.100	0.078	7sizB.pdb.gz	Structural basis for C-type inactivation in a Shaker family voltage-gated K + channel.
14	PDB:2a79B	0.333	0.335	5.235E-6	259	0.096	0.097	2a79B.pdb.gz	Crystal structure of a mammalian voltage-dependent Shaker family K+ channel.
15	PDB:3lutB	0.323	0.221	5.235E-6	390	0.096	0.064	3lutB.pdb.gz	Structure of the full-length Shaker potassium channel Kv1.2 by normal-mode-based X-ray crystallographic refinement.
16	PDB:7phhA	0.310	0.212	5.884E-6	396	0.123	0.081	7phhA.pdb.gz
17	PDB:7f3fA	0.304	0.181	2.260E-5	460	0.112	0.063	7f3fA.pdb.gz
18	PDB:7pquA	0.299	0.240	2.856E-5	328	0.108	0.085	7pquA.pdb.gz
19	PDB:7sszA	0.327	0.241	9.758E-5	362	0.100	0.072	7sszA.pdb.gz
20	PDB:6wcqC	0.301	0.560	1.208E-3	130	0.085	0.169	6wcqC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q4G0X4	0.0	541	260	1.000	1.000	KCD21_HUMAN BTB/POZ domain-containing protein KCTD21 OS=Homo sapiens OX=9606 GN=KCTD21 PE=1 SV=1
2	Q693B1	1.16e-50	167	232	0.362	0.405	KCD11_HUMAN BTB/POZ domain-containing protein KCTD11 OS=Homo sapiens OX=9606 GN=KCTD11 PE=1 SV=1
3	Q8K485	4.48e-49	163	232	0.354	0.397	KCD11_MOUSE BTB/POZ domain-containing protein KCTD11 OS=Mus musculus OX=10090 GN=Kctd11 PE=1 SV=1
4	Q8NC69	1.97e-38	136	237	0.292	0.321	KCTD6_HUMAN BTB/POZ domain-containing protein KCTD6 OS=Homo sapiens OX=9606 GN=KCTD6 PE=1 SV=2
5	Q5XJ34	2.26e-27	107	257	0.204	0.206	KC15L_DANRE BTB/POZ domain-containing protein kctd15-like OS=Danio rerio OX=7955 GN=kctd15l PE=1 SV=1
6	Q96SI1	4.10e-27	107	283	0.192	0.177	KCD15_HUMAN BTB/POZ domain-containing protein KCTD15 OS=Homo sapiens OX=9606 GN=KCTD15 PE=1 SV=1
7	Q8K0E1	5.72e-27	107	283	0.192	0.177	KCD15_MOUSE BTB/POZ domain-containing protein KCTD15 OS=Mus musculus OX=10090 GN=Kctd15 PE=1 SV=1
8	Q6DC02	1.90e-26	105	257	0.200	0.202	KCD15_DANRE BTB/POZ domain-containing protein kctd15 OS=Danio rerio OX=7955 GN=kctd15 PE=1 SV=1
9	Q719H9	4.96e-26	104	257	0.185	0.187	KCTD1_HUMAN BTB/POZ domain-containing protein KCTD1 OS=Homo sapiens OX=9606 GN=KCTD1 PE=1 SV=1
10	A0A2U3U043	2.09e-24	104	865	0.185	0.055	A0A2U3U043_HUMAN Potassium channel tetramerization domain containing 1 OS=Homo sapiens OX=9606 GN=KCTD1 PE=1 SV=1
11	D5SHR0	2.25e-23	99.4	367	0.177	0.125	TIWAZ_DROME BTB/POZ domain-containing protein Tiwaz OS=Drosophila melanogaster OX=7227 GN=twz PE=2 SV=1
12	Q8WVF5	2.53e-23	97.4	259	0.200	0.201	KCTD4_HUMAN BTB/POZ domain-containing protein KCTD4 OS=Homo sapiens OX=9606 GN=KCTD4 PE=1 SV=2
13	Q804Q4	1.08e-21	93.6	288	0.188	0.170	Q804Q4_DANRE BTB/POZ domain-containing protein KCTD12 OS=Danio rerio OX=7955 GN=lov PE=2 SV=1
14	Q5DTY9	2.59e-21	94.4	427	0.192	0.117	KCD16_MOUSE BTB/POZ domain-containing protein KCTD16 OS=Mus musculus OX=10090 GN=Kctd16 PE=1 SV=2
15	Q68DU8	3.90e-21	94.0	428	0.188	0.114	KCD16_HUMAN BTB/POZ domain-containing protein KCTD16 OS=Homo sapiens OX=9606 GN=KCTD16 PE=1 SV=1
16	Q561T3	1.76e-20	89.7	271	0.181	0.173	Q561T3_DANRE Potassium channel tetramerisation domain-containing 12.2 OS=Danio rerio OX=7955 GN=ron PE=1 SV=2
17	Q50H33	8.34e-20	90.1	476	0.185	0.101	KCTD8_MOUSE BTB/POZ domain-containing protein KCTD8 OS=Mus musculus OX=10090 GN=Kctd8 PE=1 SV=1
18	Q6ZWB6	1.41e-19	89.7	473	0.185	0.101	KCTD8_HUMAN BTB/POZ domain-containing protein KCTD8 OS=Homo sapiens OX=9606 GN=KCTD8 PE=1 SV=1
19	Q96CX2	2.53e-19	87.8	325	0.169	0.135	KCD12_HUMAN BTB/POZ domain-containing protein KCTD12 OS=Homo sapiens OX=9606 GN=KCTD12 PE=1 SV=1
20	Q6WVG3	4.31e-19	87.0	327	0.169	0.135	KCD12_MOUSE BTB/POZ domain-containing protein KCTD12 OS=Mus musculus OX=10090 GN=Kctd12 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00651 BTB	48	15.6	BTB/POZ domain
2	PF02214 BTB_2	3.5e-17	73.8	BTB/POZ domain
3	PF16017 BTB_3	0.17	23.2	BTB/POZ domain
4	PF19329 KCTD11_21_C	1.1e-92	319.3	BTB/POZ domain-containing protein KCTD11/21 C-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008564287.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008586605.1	0.568	Cullin-3
2	482537.XP_008565338.1	0.564	dnaJ homolog subfamily C member 28

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0097602	1.000	cullin family protein binding
GO:0042802	1.000	identical protein binding
GO:0042826	1.000	histone deacetylase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0044238	0.997	primary metabolic process
GO:0043170	0.996	macromolecule metabolic process
GO:1901564	0.996	organonitrogen compound metabolic process
GO:0050789	0.995	regulation of biological process
GO:0019538	0.993	protein metabolic process
GO:0044237	0.989	cellular metabolic process
GO:0050794	0.981	regulation of cellular process
GO:0006508	0.975	proteolysis
GO:1901565	0.972	organonitrogen compound catabolic process
GO:0044248	0.970	cellular catabolic process
GO:0044260	0.968	cellular macromolecule metabolic process
GO:0044265	0.959	cellular macromolecule catabolic process
GO:0030163	0.959	protein catabolic process
GO:0006511	0.953	ubiquitin-dependent protein catabolic process
GO:0009966	0.903	regulation of signal transduction
GO:0048519	0.848	negative regulation of biological process
GO:0009968	0.815	negative regulation of signal transduction
GO:0008589	0.696	regulation of smoothened signaling pathway
GO:0045879	0.650	negative regulation of smoothened signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.997	cytoplasm
GO:0005829	0.980	cytosol
GO:0043227	0.954	membrane-bounded organelle
GO:0043231	0.943	intracellular membrane-bounded organelle
GO:0012505	0.825	endomembrane system
GO:0005634	0.376	nucleus
GO:0032991	0.366	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]