StarFunc result for job id Q4G0X9

User Input

>input (1142 residues)
MAEPGGAAGRSHPEDGSASEGEKEGNNESHMVSPPEKDDGQKGEEAVGSTEHPEEVTTQA
EAAIEEGEVETEGEAAVEGEEEAVSYGDAESEEEYYYTETSSPEGQISAADTTYPYFSPP
QELPGEEAYDSVSGEAGLQGFQQEATGPPESRERRVTSPEPSHGVLGPSEQMGQVTSGPA
VGRLTGSTEEPQGQVLPMGVQHRFRLSHGSDIESSDLEEFVSQEPVIPPGVPDAHPREGD
LPVFQDQIQQPSTEEGAMAERVESEGSDEEAEDEGSQLVVLDPDHPLMVRFQAALKNYLN
RQIEKLKLDLQELVVATKQSRAQRQELGVNLYEVQQHLVHLQKLLEKSHDRHAMASSERR
QKEEELQAARALYTKTCAAANEERKKLAALQTEMENLALHLFYMQNIDQDMRDDIRVMTQ
VVKKAETERIRAEIEKKKQDLYVDQLTTRAQQLEEDIALFEAQYLAQAEDTRILRKAVSE
ACTEIDAISVEKRRIMQQWASSLVGMKHRDEAHRAVLEALRGCQHQAKSTDGEIEAYKKS
IMKEEEKNEKLASILNRTETEATLLQKLTTQCLTKQVALQSQFNTYRLTLQDTEDALSQD
QLEQMILTEELQAIRQAIQGELELRRKTDAAIREKLQEHMTSNKTTKYFNQLILRLQKEK
TNMMTHLSKINGDIAQTTLDITHTSSRLDAHQKTLVELDQDVKKVNELITNSQSEISRRT
ILIERKQGLINFLNKQLERMVSELGGEEVGPLELEIKRLSKLIDEHDGKAVQAQVTWLRL
QQEMVKVTQEQEEQLASLDASKKELHIMEQKKLRVESKIEQEKKEQKEIEHHMKDLDNDL
KKLNMLMNKNRCSSEELEQNNRVTENEFVRSLKASERETIKMQDKLNQLSEEKATLLNQL
VEAEHQIMLWEKKIQLAKEMRSSVDSEIGQTEIRAMKGEIHRMKVRLGQLLKQQEKMIRA
MELAVARRETVTTQAEGQRKMDRKALTRTDFHHKQLELRRKIRDVRKATDECTKTVLELE
ETQRNVSSSLLEKQEKLSVIQADFDTLEADLTRLGALKRQNLSEIVALQTRLKHLQAVKE
GRYVFLFRSKQSLVLERQRLDKRLALIATILDRVRDEYPQFQEALHKVSQMIANKLESPG
PS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q4G0X9	1.000	1.000	0.000	1142	1.000	1.000	Q4G0X9.pdb.gz	CCD40_HUMAN Coiled-coil domain-containing protein 40 OS=Homo sapiens OX=9606 GN=CCDC40 PE=1 SV=2
2	AFDB:Q8BI79	0.340	0.328	1.721E-89	1192	0.589	0.565	Q8BI79.pdb.gz	CCD40_MOUSE Coiled-coil domain-containing protein 40 OS=Mus musculus OX=10090 GN=Ccdc40 PE=1 SV=1
3	AFDB:Q56A40	0.135	0.161	8.323E-46	941	0.309	0.375	Q56A40.pdb.gz	CCD40_DANRE Coiled-coil domain-containing protein 40 OS=Danio rerio OX=7955 GN=ccdc40 PE=2 SV=2
4	AFDB:B9EKI3	0.070	0.073	1.002E-9	1091	0.145	0.152	B9EKI3.pdb.gz	TMF1_MOUSE TATA element modulatory factor OS=Mus musculus OX=10090 GN=Tmf1 PE=1 SV=2
5	AFDB:F4HQB9	0.157	0.181	1.420E-9	976	0.137	0.161	F4HQB9.pdb.gz	F4HQB9_ARATH Golgin Putative 5 OS=Arabidopsis thaliana OX=3702 GN=GC5 PE=1 SV=1
6	AFDB:A0A024R370	0.070	0.073	3.059E-9	1093	0.143	0.149	A0A024R370.pdb.gz
7	AFDB:Q5DU05	0.097	0.083	6.145E-9	1446	0.118	0.093	Q5DU05.pdb.gz	CE164_MOUSE Centrosomal protein of 164 kDa OS=Mus musculus OX=10090 GN=Cep164 PE=1 SV=2
8	AFDB:Q8TES7	0.068	0.069	9.338E-9	1133	0.123	0.124	Q8TES7.pdb.gz	FBF1_HUMAN Fas-binding factor 1 OS=Homo sapiens OX=9606 GN=FBF1 PE=1 SV=2
9	AFDB:Q811D2	0.111	0.085	2.313E-8	1581	0.179	0.129	Q811D2.pdb.gz	ANR26_MOUSE Ankyrin repeat domain-containing protein 26 OS=Mus musculus OX=10090 GN=Ankrd26 PE=1 SV=2
10	AFDB:Q96R06	0.078	0.076	6.141E-8	1193	0.144	0.137	Q96R06.pdb.gz	SPAG5_HUMAN Sperm-associated antigen 5 OS=Homo sapiens OX=9606 GN=SPAG5 PE=1 SV=2
11	PDB:1x0tA	0.034	0.233	3.409	106	0.011	0.113	1x0tA.pdb.gz	Crystal Structure of a Ribonuclease P Protein Ph1601p from Pyrococcus horikoshii OT3: An Archaeal Homologue of Human Nuclear Ribonuclease P Protein Rpp21(,)
12	PDB:2uwjE	0.040	0.539	3.655	70	0.007	0.114	2uwjE.pdb.gz
13	PDB:5jaaA	0.025	0.198	4.506	102	0.014	0.157	5jaaA.pdb.gz
14	PDB:7pzyz	0.042	0.223	4.831	179	0.011	0.073	7pzyz.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
15	PDB:7suk5	0.040	0.122	5.180	296	0.015	0.057	7suk5.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
16	PDB:7qooH	0.042	0.165	5.955	210	0.026	0.143	7qooH.pdb.gz	Structure of the human inner kinetochore CCAN complex and its significance for human centromere organization.
17	PDB:4ob3A	0.038	0.150	6.386	204	0.008	0.044	4ob3A.pdb.gz	The active site sulfenic acid ligand in nitrile hydratases can function as a nucleophile.
18	PDB:7dvq7	0.037	0.334	6.386	81	0.010	0.136	7dvq7.pdb.gz	Structure of the activated human minor spliceosome.
19	PDB:7y4sA	0.065	0.177	6.386	343	0.030	0.099	7y4sA.pdb.gz
20	PDB:5lj3G	0.047	0.398	6.847	97	0.011	0.124	5lj3G.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q4G0X9	0.0	2325	1142	1.000	1.000	CCD40_HUMAN Coiled-coil domain-containing protein 40 OS=Homo sapiens OX=9606 GN=CCDC40 PE=1 SV=2
2	Q8BI79	0.0	1262	1192	0.561	0.538	CCD40_MOUSE Coiled-coil domain-containing protein 40 OS=Mus musculus OX=10090 GN=Ccdc40 PE=1 SV=1
3	Q56A40	1.31e-180	555	941	0.305	0.370	CCD40_DANRE Coiled-coil domain-containing protein 40 OS=Danio rerio OX=7955 GN=ccdc40 PE=2 SV=2
4	A8IQT2	9.63e-09	62.0	576	0.060	0.120	CCD40_CHLRE Coiled-coil domain-containing protein 40 homolog OS=Chlamydomonas reinhardtii OX=3055 GN=CCDC40 PE=1 SV=1
5	M9PCK8	0.33	37.7	960	0.052	0.061	M9PCK8_DROME Centrosomal protein 135kDa, isoform C OS=Drosophila melanogaster OX=7227 GN=Cep135 PE=4 SV=1
6	O64046	0.43	37.4	2285	0.029	0.014	TMP_BPSPB Probable tape measure protein OS=Bacillus phage SPbeta OX=2932878 GN=yomI PE=3 SV=1
7	Q960T6	0.49	37.0	1059	0.052	0.056	Q960T6_DROME Centrosomal protein 135kDa, isoform A OS=Drosophila melanogaster OX=7227 GN=Cep135 PE=1 SV=1
8	M9MSL4	0.54	37.0	1065	0.052	0.055	M9MSL4_DROME Centrosomal protein 135kDa, isoform B OS=Drosophila melanogaster OX=7227 GN=Cep135 PE=4 SV=1
9	Q16204	0.62	36.6	474	0.046	0.112	CCDC6_HUMAN Coiled-coil domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CCDC6 PE=1 SV=2
10	E7F8Q6	2.7	34.7	968	0.020	0.024	E7F8Q6_DANRE Angiomotin OS=Danio rerio OX=7955 GN=amot PE=3 SV=3
11	P93203	5.2	33.5	697	0.067	0.110	MFP1_SOLLC MAR-binding filament-like protein 1 OS=Solanum lycopersicum OX=4081 GN=MFP1 PE=1 SV=1
12	Q17383	6.5	33.5	1839	0.054	0.034	Q17383_CAEEL Hum-2 OS=Caenorhabditis elegans OX=6239 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08647 BRE1	3e-18	77.0	BRE1 E3 ubiquitin ligase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380679

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000405708	0.992	Coiled-coil domain-containing protein 39
2	9606.ENSP00000312706	0.907	Coiled-coil domain-containing protein 65
3	9606.ENSP00000265104	0.891	Dynein heavy chain 5, axonemal
4	9606.ENSP00000391692	0.891	Coiled-coil domain containing 103
5	9606.ENSP00000484634	0.891	Protein tilB homolog
6	9606.ENSP00000361238	0.890	Radial spoke head 9 homolog
7	9606.ENSP00000391869	0.889	annotation not available
8	9606.ENSP00000288710	0.874	Dynein regulatory complex protein 1
9	9606.ENSP00000229554	0.872	Radial spoke head protein 4 homolog A
10	9606.ENSP00000480538	0.870	Dynein intermediate chain 1, axonemal
11	9606.ENSP00000268699	0.868	Growth arrest-specific protein 8
12	9606.ENSP00000348757	0.836	Coiled-coil domain-containing protein 151
13	9606.ENSP00000475939	0.835	Dynein heavy chain 11, axonemal
14	9606.ENSP00000400252	0.799	Dynein intermediate chain 2, axonemal
15	9606.ENSP00000318429	0.798	Coiled-coil domain-containing protein 114
16	9606.ENSP00000298292	0.794	Protein kintoun
17	9606.ENSP00000377197	0.790	Hydrocephalus-inducing protein homolog
18	9606.ENSP00000297440	0.782	Dynein assembly factor 5, axonemal
19	9606.ENSP00000436975	0.769	Dynein assembly factor 3, axonemal
20	9606.ENSP00000231749	0.767	Zinc finger MYND domain-containing protein 10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0016043	0.976	cellular component organization
GO:0006996	0.968	organelle organization
GO:0022607	0.967	cellular component assembly
GO:0060285	0.962	cilium-dependent cell motility
GO:0044458	0.961	motile cilium assembly
GO:0070286	0.940	axonemal dynein complex assembly
GO:0003341	0.936	cilium movement
GO:0030323	0.931	respiratory tube development
GO:0007368	0.929	determination of left/right symmetry
GO:0060541	0.924	respiratory system development
GO:0060294	0.920	cilium movement involved in cell motility
GO:0097722	0.906	sperm motility
GO:0050794	0.887	regulation of cellular process
GO:0030324	0.880	lung development
GO:0060287	0.878	epithelial cilium movement involved in determination of left/right asymmetry
GO:0048565	0.805	digestive tract development
GO:0001889	0.798	liver development
GO:0007507	0.777	heart development
GO:0071907	0.753	determination of digestive tract left/right asymmetry
GO:0071910	0.753	determination of liver left/right asymmetry
GO:0003007	0.742	heart morphogenesis
GO:0060562	0.740	epithelial tube morphogenesis
GO:0030317	0.656	flagellated sperm motility
GO:0035050	0.620	embryonic heart tube development
GO:0003143	0.567	embryonic heart tube morphogenesis
GO:0032886	0.498	regulation of microtubule-based process
GO:0003352	0.422	regulation of cilium movement
GO:0061371	0.378	determination of heart left/right asymmetry
GO:0001947	0.362	heart looping

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005929	1.000	cilium
GO:0005856	0.996	cytoskeleton
GO:0005930	0.994	axoneme
GO:0070013	0.453	intracellular organelle lumen
GO:0043231	0.452	intracellular membrane-bounded organelle
GO:0031514	0.431	motile cilium
GO:0005634	0.338	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]