StarFunc result for job id Q4G163

User Input

>input (708 residues)
MSFKDKDERISCLEAYVTLTSKSSRFTDETEILKMSQRHSGQAGTEAGNGADSPPIVNSK
YSTFRDFCSTSSFQDSGYNELKSCSFDNIDKEYLGKKEKGPTLLYEHPETSGLGLTHPLE
SPTQKKKCILPRKEKDKTPELCETPKISGKKCLPRRRLNVSFALLKGDFESQNSSLESSI
SQVINLEKNIPSSASGFSRANNFSPLVTSTLKTEEVTSCSQKLRLNFSQQKTSTIDDSKD
DCSLFEVECISPIQGNNFKDSITHDFSDSSLCINDENACPELLGSSVSGTTCGTDEDIFV
TPISNLVANIRFNASQILSPSPEVRGSISTPEDSGFNSLSLEKSEDSLSDQEGSFQELLQ
KHKGTPKVGDTIRKTRHLGRSRRLSTLREQSSQSETEEEKQIVHPDSEKRAAAASAISEG
QLSSDESGDLTFSLKNLSKTPALQLVHELFMKSKRKRLQENSGHEFLEQGDGEKIAVLQC
ILAGLIGKKMGIEKLDILTELKYRNLKHILAMVLESLTAESLCSVWKVSRNWREIVVQDK
NANRRRKFYITQLKTDSEGAVLNVEDAATRLQLLNRSALRSVQAQARIPGSQREQGSTLS
PWGEVLTPLASSSVTHLSSKQEEYVKVAKTLFTDEALKPCPRCQSPAKYQPYKKRGLCSR
TACGFDFCVLCLCAYHGSEECSRGAAKPRNRKDALPGSAQSKRNLKRL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q4G163	1.000	1.000	3.066E-101	708	1.000	1.000	Q4G163.pdb.gz	FBX43_HUMAN F-box only protein 43 OS=Homo sapiens OX=9606 GN=FBXO43 PE=1 SV=3
2	PDB:7qe7S	0.089	0.593	9.226E-8	100	0.065	0.460	7qe7S.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
3	PDB:4ui9S	0.085	0.559	8.355E-5	94	0.052	0.394	4ui9S.pdb.gz	Atomic Structure of the Apc and its Mechanism of Protein Ubiquitination
4	AFDB:F4HXQ7	0.060	0.042	2.864E-4	1113	0.154	0.098	F4HXQ7.pdb.gz	MYOB1_ARATH Myosin-binding protein 1 OS=Arabidopsis thaliana OX=3702 GN=MYOB1 PE=1 SV=1
5	AFDB:Q9W3D1	0.056	0.039	7.439E-4	1183	0.137	0.082	Q9W3D1.pdb.gz	Q9W3D1_DROME Chromatin assembly factor 1, p180 subunit OS=Drosophila melanogaster OX=7227 GN=Caf1-180 PE=1 SV=1
6	AFDB:A0A1D8PFD3	0.070	0.053	7.927E-4	1001	0.145	0.103	A0A1D8PFD3.pdb.gz	A0A1D8PFD3_CANAL Snt1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SNT1 PE=4 SV=1
7	AFDB:Q9VED3	0.079	0.053	1.319E-3	1186	0.117	0.070	Q9VED3.pdb.gz	Q9VED3_DROME Stripe, isoform A OS=Drosophila melanogaster OX=7227 GN=sr PE=4 SV=1
8	AFDB:Q9Y2W1	0.074	0.060	1.596E-3	955	0.129	0.095	Q9Y2W1.pdb.gz	TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2
9	AFDB:Q9Y6F6	0.051	0.042	3.426E-3	904	0.143	0.112	Q9Y6F6.pdb.gz	IRAG1_HUMAN Inositol 1,4,5-triphosphate receptor associated 1 OS=Homo sapiens OX=9606 GN=IRAG1 PE=1 SV=4
10	AFDB:Q96R06	0.051	0.036	3.890E-3	1193	0.119	0.070	Q96R06.pdb.gz	SPAG5_HUMAN Sperm-associated antigen 5 OS=Homo sapiens OX=9606 GN=SPAG5 PE=1 SV=2
11	AFDB:Q8IE95	0.072	0.026	5.348E-3	2548	0.155	0.043	Q8IE95.pdb.gz	SETVS_PLAF7 Variant-silencing SET domain-containing protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=SETVS PE=2 SV=1
12	AFDB:X6REB3	0.053	0.054	5.699E-3	679	0.147	0.153	X6REB3.pdb.gz	X6REB3_HUMAN Transcription factor 3 OS=Homo sapiens OX=9606 GN=TCF3 PE=1 SV=2
13	PDB:5tteB	0.074	0.112	4.548E-2	442	0.025	0.041	5tteB.pdb.gz	Structural insights into the mechanism and E2 specificity of the RBR E3 ubiquitin ligase HHARI.
14	PDB:4zynB	0.073	0.122	7.099E-2	385	0.021	0.039	4zynB.pdb.gz	A Ubl/ubiquitin switch in the activation of Parkin.
15	PDB:6ttuT	0.057	0.102	2.094E-1	394	0.021	0.038	6ttuT.pdb.gz	NEDD8 nucleates a multivalent cullin-RING-UBE2D ubiquitin ligation assembly.
16	PDB:4kblA	0.060	0.102	2.378E-1	395	0.023	0.041	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
17	PDB:6o60C	0.040	0.073	9.644E-1	389	0.010	0.018	6o60C.pdb.gz	GGTase3 is a newly identified geranylgeranyltransferase targeting a ubiquitin ligase.
18	PDB:7qp6y	0.057	0.058	1.095	697	0.041	0.042	7qp6y.pdb.gz	Conformational rearrangements upon start codon recognition in human 48S translation initiation complex.
19	PDB:5n5yI	0.039	0.247	1.413	99	0.018	0.131	5n5yI.pdb.gz	Structural Basis of RNA Polymerase I Transcription Initiation.
20	PDB:7oqyY	0.047	0.310	1.604	92	0.016	0.120	7oqyY.pdb.gz	Structural basis of RNA polymerase inhibition by viral and host factors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q4G163	0.0	1447	708	1.000	1.000	FBX43_HUMAN F-box only protein 43 OS=Homo sapiens OX=9606 GN=FBXO43 PE=1 SV=3
2	Q8CDI2	0.0	837	640	0.617	0.683	FBX43_MOUSE F-box only protein 43 OS=Mus musculus OX=10090 GN=Fbxo43 PE=1 SV=2
3	Q8AXF4	2.12e-148	448	651	0.422	0.459	FBX43_XENLA F-box only protein 43 OS=Xenopus laevis OX=8355 GN=fbxo43 PE=1 SV=1
4	Q9UKT4	4.77e-38	149	447	0.126	0.199	FBX5_HUMAN F-box only protein 5 OS=Homo sapiens OX=9606 GN=FBXO5 PE=1 SV=1
5	Q7TSG3	1.70e-36	144	421	0.123	0.207	FBX5_MOUSE F-box only protein 5 OS=Mus musculus OX=10090 GN=Fbxo5 PE=1 SV=1
6	Q90Z80	1.35e-30	126	392	0.121	0.219	FBX5A_XENLA F-box only protein 5-A OS=Xenopus laevis OX=8355 GN=fbxo5-a PE=1 SV=1
7	Q0V967	3.40e-26	113	384	0.107	0.198	FBX5_DANRE F-box only protein 5 OS=Danio rerio OX=7955 GN=fbxo5 PE=1 SV=2
8	Q9UBS8	0.001	44.3	474	0.040	0.059	RNF14_HUMAN E3 ubiquitin-protein ligase RNF14 OS=Homo sapiens OX=9606 GN=RNF14 PE=1 SV=1
9	Q7KTX7	0.070	38.9	482	0.018	0.027	PRKN_DROME E3 ubiquitin-protein ligase parkin OS=Drosophila melanogaster OX=7227 GN=park PE=1 SV=1
10	Q9VM76	0.22	37.0	411	0.082	0.141	Q9VM76_DROME GH14043p OS=Drosophila melanogaster OX=7227 GN=Rca1 PE=2 SV=1
11	Q8IDA0	0.24	37.4	3179	0.030	0.007	GCYB_PLAF7 Guanylate cyclase beta OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=GCbeta PE=1 SV=2
12	Q9US46	0.28	36.6	435	0.025	0.041	ITT1_SCHPO E3 ubiquitin-protein ligase itt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=itt1 PE=3 SV=1
13	O01965	0.33	36.6	494	0.032	0.047	ARI11_CAEEL E3 ubiquitin-protein ligase ari-1.1 OS=Caenorhabditis elegans OX=6239 GN=ari-1.1 PE=1 SV=3
14	Q9NV58	0.58	35.8	838	0.031	0.026	RN19A_HUMAN E3 ubiquitin-protein ligase RNF19A OS=Homo sapiens OX=9606 GN=RNF19A PE=1 SV=3
15	Q9P2G1	0.71	35.8	1089	0.028	0.018	AKIB1_HUMAN Ankyrin repeat and IBR domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ANKIB1 PE=1 SV=3
16	P50636	0.82	35.4	840	0.031	0.026	RN19A_MOUSE E3 ubiquitin-protein ligase RNF19A OS=Mus musculus OX=10090 GN=Rnf19a PE=1 SV=2
17	F1RB95	1.2	34.7	459	0.032	0.050	RNF14_DANRE E3 ubiquitin-protein ligase RNF14 OS=Danio rerio OX=7955 GN=rnf14 PE=2 SV=1
18	A0A2R8QFQ6	1.5	34.7	562	0.024	0.030	FB11A_DANRE F-box and WD repeat domain-containing 11-A OS=Danio rerio OX=7955 GN=fbxw11a PE=2 SV=1
19	Q8W468	1.6	34.3	567	0.034	0.042	ARI8_ARATH Probable E3 ubiquitin-protein ligase ARI8 OS=Arabidopsis thaliana OX=3702 GN=ARI8 PE=2 SV=1
20	A0A0K3AU72	1.9	34.3	1698	0.044	0.018	A0A0K3AU72_CAEEL Formin HOmology Domain OS=Caenorhabditis elegans OX=6239 GN=fhod-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15130 DUF4566	20	16.1	Domain of unknown function (DUF4566)
2	PF00646 F-box	2.9	19.1	F-box domain
3	PF12937 F-box-like	65	14.8	F-box-like
4	PF01485 IBR	0.11	23.9	IBR domain, a half RING-finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000403293

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361540	0.982	Cell division cycle protein 20 homolog
2	9606.ENSP00000300093	0.971	Serine/threonine-protein kinase PLK1
3	9606.ENSP00000378699	0.924	Cyclin-dependent kinase 1
4	9606.ENSP00000256442	0.914	G2/mitotic-specific cyclin-B1
5	9606.ENSP00000231487	0.912	S-phase kinase-associated protein 1
6	9606.ENSP00000359206	0.898	F-box/WD repeat-containing protein 1A
7	9606.ENSP00000326804	0.882	Cullin-1
8	9606.ENSP00000324804	0.840	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
9	9606.ENSP00000216225	0.831	E3 ubiquitin-protein ligase RBX1
10	9606.ENSP00000381412	0.816	Calcium/calmodulin-dependent protein kinase type II subunit alpha
11	9606.ENSP00000265094	0.813	F-box/WD repeat-containing protein 11
12	9606.ENSP00000379098	0.812	Calcium/calmodulin-dependent protein kinase type II subunit beta
13	9606.ENSP00000339740	0.809	Calcium/calmodulin-dependent protein kinase type II subunit delta
14	9606.ENSP00000221138	0.807	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
15	9606.ENSP00000418447	0.807	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
16	9606.ENSP00000311344	0.800	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform
17	9606.ENSP00000478501	0.774	Anaphase-promoting complex subunit 10
18	9606.ENSP00000230056	0.733	Geminin
19	9606.ENSP00000314004	0.728	Anaphase-promoting complex subunit 2
20	9606.ENSP00000380747	0.711	Transmembrane protein 209

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.353	catalytic activity
GO:0140096	0.330	catalytic activity, acting on a protein

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0048519	0.918	negative regulation of biological process
GO:0048523	0.908	negative regulation of cellular process
GO:0009987	0.875	cellular process
GO:0051726	0.865	regulation of cell cycle
GO:0010564	0.856	regulation of cell cycle process
GO:0010948	0.818	negative regulation of cell cycle process
GO:0008152	0.777	metabolic process
GO:0044238	0.767	primary metabolic process
GO:0071704	0.726	organic substance metabolic process
GO:0006807	0.696	nitrogen compound metabolic process
GO:0043170	0.680	macromolecule metabolic process
GO:0019222	0.638	regulation of metabolic process
GO:0019538	0.537	protein metabolic process
GO:0060255	0.505	regulation of macromolecule metabolic process
GO:0080090	0.504	regulation of primary metabolic process
GO:0051171	0.504	regulation of nitrogen compound metabolic process
GO:0044237	0.408	cellular metabolic process
GO:0007049	0.360	cell cycle
GO:0051246	0.324	regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.995	nuclear lumen
GO:0005654	0.993	nucleoplasm
GO:0005829	0.957	cytosol
GO:0001674	0.819	female germ cell nucleus
GO:0032991	0.541	protein-containing complex
GO:0043232	0.462	intracellular non-membrane-bounded organelle
GO:0015630	0.304	microtubule cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]